triangle PDBeMotif: 4jzj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cytokine receptor/immune system    | release date: Wed, Apr 3, 2013
Title crystal structure of receptor-fab complex
Authors M.W.PARKER, S.E.BROUGHTON
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search FUC FUC binding statistics FUC   search MAN MAN binding statistics MAN   search FUL FUL binding statistics FUL   search GOL GOL binding statistics GOL
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains C,D sequence:
KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSF
QLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGVNTRAWRTS
Chains A,H sequence:
EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQMPGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTY
LQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS
WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Chains B,L sequence:
DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLTWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : INTERLEUKIN-3 RECEPTOR SUBUNIT ALPHA
member of: GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23036/searchPTHR23036_SF77PFAM:searchPF09240PROSITE PATTERNS:searchPS01356, SUPERFAMILY:searchSSF49265UniProt:searchP26951
JMol viewer RasMol script viewer  NAG 408C  ..                      * *                                                   ..                                                                                                                 ..NAG ..                      ..                 ..                      
JMol viewer RasMol script viewer  FUL 407C  ..                      | |                                            *      ..                                                                                                                 ..FUL ..                      ..                 ..                      
JMol viewer RasMol script viewer  NAG 401C  ..                      | |                               * *          * *    ..                                                                                                                 ..NAG ..                      ..                 ..                      
JMol viewer RasMol script viewer  NAG 403C  ..                      | |                               | |        * | |    ..                                                                                                                 ..NAG ..                      ..                 ..                      
JMol viewer RasMol script viewer  FUL 402C  ..                      | |       *                       | |        | | |    ..                                                                                                                 ..FUL ..                      ..                 ..                      
sec str:  .....eeeeeee....eeeeee......eeeee...eeee.....eee.........eeeeeee....eeeeeee.........eeeeeeeee...eeeeeeee........eeeeeeee...eeee..eeee.....eeeeee.hhhhhh....eeeeeeeee........eeeeeehhhhh.....eee..... ...eeeee........eeeeeee....eeeee....eee.......eeeeeee..............
sequence :  ..NPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN..PWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAK... ..SFMHWKMRSHFNRKFRYELQIQ..VITEQVRDRTSFQLLNP..TVQIRARERVYEFLSAWSTPQR
seq num:  ..24        34        44        54        64        74        84        94    ..103       113       123       133       143       153       163       173       183       193       203          ... ..221       231         ..248       258    ..268       278         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            | |       ^*** |    | |    |^***      |  |  ^***|               ..      ^***   |  ||      |  ||  |         |||   |  |    |||   |   |||  | |    |      | | |   |||    |  |     ^***|..PS00001..        | ||          ..                 ..    |     | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | |         |  |    | |    | |||      |  |    ^**               ..             |  ||      |  ||  |         |||   |  |    |||   |   |||  | |    |      | | |   ^**    |  |       ^**..PS00005..        | ||          ..                 ..    |     | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | |         ^***    | |    | |||      ^***                      ..             |  ||      |  ||  |         |||   |  |    |||   |   |||  | |    |      | | |    |     ^***          ..PS00006..        | ||          ..                 ..    |     | |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | |                 | |    | |||      |  |                      ..             |  ||      |  ||  |         |********^    |||   |   |||  | |    |      | | |    |     |  |          ..PS00007..        | ||          ..                 ..    ******^ |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |                 | |    | |||      |  |                      ..             |  ||      |  ||  |         | |   |       |^*****   |||  | ^*****      | | ^*****     |  |          ..PS00008..        | ||          ..                 ..          | |         
search RasMol script viewer Motif-ligand binding stats  HEMATOPO_REC_S_F2 ..            | |                 | |    | |||      |  |                      ..             |  |*******************************       | |       |||  | |           | |            |  |          ..PS01356..        | ||          ..                 ..          | |         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            | |                 | |    *****      |  |                      ..             |  |       |  ||  |         | |           | |       |||  | |           | |            |  |          ..betabulgeloop..        | ||          ..                 ..          | |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |                 | |    ****|      |  |                      ..             |  |       |  ||  |         | |           | |       |||  | |           | |            |  |          ..betaturn..        | ||          ..                 ..          | |         
search RasMol script viewer Motif-ligand binding stats  nest ..            ***                 ***      ***      |  |                      ..             |  |       |  ||  |         ***           ***       ***  ***           | |            |  |          ..nest..        | ||          ..                 ..          ***         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                  ****                      ..             ****       ********                                  |   |             | |            ****          ..niche..        ****          ..                 ..                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                            ..                                                                  *****             | |                          ..ststaple..        | |           ..                 ..                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                            ..                                                                                    ***                          ..stturn..        ***           ..                 ..                      

chain D : INTERLEUKIN-3 RECEPTOR SUBUNIT ALPHA
member of: GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23036/searchPTHR23036_SF77PFAM:searchPF09240PROSITE PATTERNS:searchPS01356, SUPERFAMILY:searchSSF49265UniProt:searchP26951
JMol viewer RasMol script viewer  GOL 410D  ..                                                  *                                                                                                            *                               ..GOL ..                      ..              ..                        
JMol viewer RasMol script viewer  FUC 408D  ..                                                  |                                                                                                            |                               ..FUC ..                      ..              ..                        
JMol viewer RasMol script viewer  NAG 407D  ..                                                  |                                **               *                                                          |                               ..NAG ..                      ..              ..                        
JMol viewer RasMol script viewer  FUL 406D  ..                                                  |                                ||               |                                                          |                               ..FUL ..                      ..              ..                        
JMol viewer RasMol script viewer  FUL 405D  ..                                                  |                 *              ||               |                                                          |                               ..FUL ..                      ..              ..                        
JMol viewer RasMol script viewer  NAG 401D  ..                                                  |    * *          *              ||               |                                                          |                               ..NAG ..                      ..              ..                        
JMol viewer RasMol script viewer  FUL 404D  ..                                                  |    | |          |              ||               |                                                          |                               ..FUL ..                      ..              ..                        
JMol viewer RasMol script viewer  NAG 402D  ..                                                  |    | |          *              ||               |                                                          |                               ..NAG ..                      ..              ..                        
sec str:  ....eeeeeee....eeeeee......eeeee...eeee.....eee.........eeeeeee....eeeeeee...........eeeeeeee...eeeeeee.........eeeeeee...........eee.....eeeeee.hhhhhhh...eeeeeeeee....eeeeeeeeeehhhhh.....eee..... ...eeeee........eeeeeee....eeeee....eee....eee..eee............ee.
sequence :  ..PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVAKRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAK... ..SFMHWKMRSHFNRKFRYELQIQ..VITEQVRDRTSFQL..YTVQIRARERVYEFLSAWSTPQRF
seq num:  ..25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205        ... ..221       231         ..248       258 ..267       277       287 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |     | |       ^*** |    | |    |^***      |  |  ^***|               | |    | ^***   |  ||          |  |       ||||    |  |  | ||| |||   |||  | |    |      |  ||   |||    |  |     ^***|..PS00001..        | ||          ..              ..     |     | |     | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     | |         |  |    | |    | |||      |  |    ^**               ^**    |  |     |  ||          |  |       ||||    |  |  | ||| |||   |||  | |    |      |  ||   ^**    |  |       ^**..PS00005..        | ||          ..              ..     |     | |     | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |     | |         ^***    | |    | |||      ^***                             |  |     |  ||          |  |       ||||    |  |  | ||| |||   |||  | |    |      |  ||    |     ^***          ..PS00006..        | ||          ..              ..     |     | |     | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |     | |                 | |    | |||                                       |  |     |  ||          |  |       |||********^  | ||| |||   |||  | |    |      |  ||    |     |  |          ..PS00007..        | ||          ..              ..     ******^ |     | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |     | |                 | |    | |||                                       |  |     |  ||          |  |       ||||    |     | |^*****   |||  | ^*****      |  |^*****     |  |          ..PS00008..        | ||          ..              ..           | |     | |  
search RasMol script viewer Motif-ligand binding stats  HEMATOPO_REC_S_F2 ..  |  |     | |                 | |    | |||                                       |  |     |  |*******************************     | | | ||    |||  | |           |  |           |  |          ..PS01356..        | ||          ..              ..           | |     | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     | |                 | |    | |||                                       |  |     |  |           |  |       ||||          *** | ||    |||  | |           |  |           |  |          ..asxturn..        | ||          ..              ..           | |     | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     | |                 | |    | |||                                       |  |     |  |           |  |       ||||            | | **    |||  | |           |  |           |  |          ..betabulge..        | ||          ..              ..           | |     | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |     | |                 | |    ****|                                       |  |     |  |           |  |       ||||            | |       |||  | |           |  |           |  |          ..betaturn..        | ||          ..              ..           | |     | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |     | |                 | |      | |                                       |  |     |  |           |  |       ||||            | |       |||  | |           |  |           |  |          ..gammaturn..        | ||          ..              ..           | |     ***  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |     ***                 ***      ***                                       |  |     |  |           |  |       ****            ***       ***  ***           |  |           |  |          ..nest..        | ||          ..              ..           ***          
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                                                            ****     ****           ****        ***                       |   |             ****           ****          ..niche..        ****          ..              ..                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                *****                                          ..ststaple..        | |           ..              ..                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                               ..stturn..        ***           ..              ..                        

chain A : FAB HEAVY CHAIN
JMol viewer RasMol script viewer  FUL 404D  ..                                                         **                                                                          ..                                                                                 
JMol viewer RasMol script viewer  NAG 402D  ..                                                        *||                                                                          ..                                                                                 
JMol viewer RasMol script viewer  BMA 403D  ..                                                        |||                                                                          ..                                                                                 
sec str:  ....eeee...eee.....eeeeeeee........eeeeee.....eeeeeee......eee.hhhh...eeeee....eeeeee...hhhhheeeeeee..........ee...eeeee........eeeee.....eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.hhhhh..eeeeeeehhhheeeeeee...
sequence :  ..EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQMPGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTYLQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSSASTKGPSVFPLAP..GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121          ..141       151       161       171       181       191       201       211        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |  |  |^** ^**|   || ||       |  |    ||     | |       |  |    |  | |      ^**| ||  |     |  |  | ||   |    || |^**         ..    |                  | |||||         | |             |  | | |   || |||  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***  |  |       |   ^***|       |  |    ||     | |       |  |    |  | |        || ||  |     |  |  | ||   |    || |            ..    |                  | |||||         | |             |  | | |   || ||^***      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            |  |       |    |  |       |  |    ||     | |       |  |    |  | |        *******^     |  |  | ||   |    || |            ..    |                  | |||||         | |             |  | | |   || |||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |       ^*****  |       |  |    ||     | |       |  |    |  | |        || ||        |  |  | ||   ^*****| |            ..*****                  ^*****|         | |             |  | | |   || |||         
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..            |  |            |  |       |  |    ||     | |       |  |    |  | |        || ||        |  |  | ||         | |            ..                       | ||| |         | |             |  | **^****| |||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |            |  |       |  |    **     | |       |  |    |  | |        || ||        |  |  | **         | |            ..                       | ||| |         | |             |  |       || |||         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |            |  |       |  |           | |       |  |    ******        || ||        |  |  |            | |            ..                       | ||| |         | |             |  |       ******         
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |            |  |       |  |           | |       |  |       | |        ****|        ****  |            | |            ..                       | ||| |         | |             |  |        ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |            |  |       |  |           ***       |  |       ***         |  |           |  |            | |            ..                       ***|| |         ***             |  |          ***         
search RasMol script viewer Motif-ligand binding stats  niche ..            ****            ****       ****                     ****                   ****           ****            ***            ..                         *****                         ****                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                      ***            ..                                                                                 

chain B : FAB LIGHT CHAIN
sec str:  .....eeee..eeee.....eeeeeee.............eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee...........eeeee.......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..ee....eeeee.........eeeeeeeeeehhhhh...eeeeeee.......eeeeee...
sequence :  ..DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLTWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  |          | |  || | |      |  |    || ||^**|  ||  | |  | ||        || ||      |  |        |  |                  |  | |           | |      |  |   | |  |  |    | |         |  ||  |  | |   |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***          | |  || | |      |  |    || ||^***  ||  | |  ^***        || ||      |  |        ^***                  |  | |           | |      |  |   | |  ^***    | |         ^***|  |  | |   |  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |          | |  ^*****      |  |    || |||| |  ||  | ^*****         || ||      |  |                              |  | |           | |      |  |   | |          | |         |   |  |  | |   |  |            
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..             |  |          | |   | |        |  |    || |||| |  ||  |    | |         || ||      |  |                              |  | |           | |      |  |   | |          | |         |   |  |  **^****  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..             |  |          | |   | |        |  |    ** |||| |  ||  |    | |         || ||      |  |                              |  | |           | |      |  |   | |          | |         |   |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |          | |   | |        ****       |||| ****|  |    | |         ****|      |  |                              **** |           | |      ****   | |          | |         |   |  |        ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |          | |   | |        |  |       ***| |  ||  |    ***          |  |      |  |                                 | |           | |             | |          | |         |   |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |          | |   ***        |  |        *** |  ||  |                 |  |      |  |                                 ***           | |             ***          ***         |   |  |        |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..             ****          ***              ****            ********                 ****      ****                                               ***                                      |   ****        ****            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                           | |                                                                                                                                                             *****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                                                                                                                                                                             

chain H : FAB HEAVY CHAIN
JMol viewer RasMol script viewer  GOL 301H  ..                                                                                                                                      ..                                 * *       ***                                   
JMol viewer RasMol script viewer  NAG 401C  ..                                                                                                                                      ..                                 | |       |||                                   
JMol viewer RasMol script viewer  NAG 403C  ..                                                        ***                                                                           ..                                 | |       |||                                   
JMol viewer RasMol script viewer  FUL 402C  ..                                                        |||* *  *                                                                     ..                                 | |       |||                                   
JMol viewer RasMol script viewer  BMA 404C  ..                                                        |||| |  |                                                                     ..                                 | |       |||                                   
JMol viewer RasMol script viewer  MAN 405C  ..                                                      * *||| |  |                                                                     ..                                 | |       |||                                   
sec str:  ....eeee...eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eeehhhhhh..eeeee....eeeeee...hhhhheeeeeee..........ee...eeeee........eeeee......eeeeeeeeeee.....eeee.hhh....eee...ee.....eeeeeeeeee.hhh.....eeeeeehhhheeeeee....
sequence :  ..EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYYMKWARQMPGKGLEWMGDIIPSNGATFYNQKFKGQVTISADKSISTTYLQWSSLKASDTAMYYCARSHLLRASWFAYWGQGTMVTVSSASTKGPSVFPLAPS..GTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131 ..141       151       161       171       181       191       201       211        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |  |  |^** ^**|  ||| ||                   |  | |   | | |  |    |  | |      ^**| ||  |     |  |  | ||   |    || |^**         ^..    |               |  | || ||         | |                  | |   || |||  |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***  |  |       |  |^***|                   |  | |   | | |  |    |  | |        || ||  |     |  |  | ||   |    || |             ..    |               |  | || ||         | |                  | |   || ||^***      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            |  |       |  | |  |                   |  | |   | | |  |    |  | |        *******^     |  |  | ||   |    || |             ..    |               |  | || ||         | |                  | |   || |||         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |       ^*****  |                   |  | |   | | |  |    |  | |        || ||        |  |  | ||   ^*****| |             ..*****               |  ^*****|         | |                  | |   || |||         
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..            |  |       |  | |  |                   |  | |   | | |  |    |  | |        || ||        |  |  | ||         | |             ..                    |  | ||  |         | |                  **^****| |||         
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  |       |  | |  |                   |  | |   *** |  |    |  | |        || ||        |  |  | ||         | |             ..                    |  | ||  |         | |                         | |||         
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |       |  | |  |                   |  | |       |  |    |  | |        || ||        |  |  | **         | |             ..                    |  | ||  |         | |                         | |||         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  |       |  | |  |                   ******       |  |    ******        || ||        |  |  |            | |             ..                    |  | ||  |         | |                         | |||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****       |  | |  |                      | |       |  |       | |        ****|        |  |  |            | |             ..                    **** ||  |         | |                         ****|         
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |       |  | |  |                      ***       |  |       ***         |  |        |  |  |            | |             ..                       ***|  |         ***                           ***         
search RasMol script viewer Motif-ligand binding stats  niche ..            ****       **** ****                                ****                   ****        *******            ***             ..                          ****                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                      ***             ..                                                                                 

chain L : FAB LIGHT CHAIN
JMol viewer RasMol script viewer  GOL 301H  ..                                                                                                                                                                       *             * *                                   
JMol viewer RasMol script viewer  FUL 402C  ..                                                                                                                                                                       |             | |                                   
sec str:  .....eeee..eeeee....eeeeeee....ee....ee.eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhheeeeeee...........eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..ee....eeeee.........eeeeeeeeeehhhhh...eeeeeee.......eeeeee...
sequence :  ..DIVMTQSPDSLAVSLGERATINCESSQSLLNSGNQKNYLTWYQQKPGQPPKPLIYWASTRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQNDYSYPYTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  |          | |  || | |      |  |    || ||^**|  ||  | |  | ||         |  |      | || | |    |  |                   | |||           | |             | |  |  | | || |         |  ||  | || |   |  |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***          | |  || | |      |  |    || ||^***  ||  | |  ^***         |  |      | || | |    ^***                   | |||           | |             | |  ^*** | || |         ^***|  | || |   |  |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                           | |  ^*****      |  |    || |||| |  ||  | ^*****          |  |      | || | |                           | |||           | |             | |       | || |             |  | || |   |  |            
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..                           | |   | |        |  |    || |||| |  ||  |    | |          |  |      | || | |                           | |||           | |             | |       | || |             |  | |**^****  |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..                           | |   ***        |  |    || |||| |  ||  |    | |          |  |      ***| | |                           | |||           | |             | |       ******             |  | |      |  |            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                           | |   | |        |  |    ** |||| |  ||  |    | |          |  |      |  | | |                           | |||           | |             | |          | |             |  | |      |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           | |   | |        ****       |||| ****|  |    | |          |  |      |  | | |                           ****|           | |             | |          | |             |  | |      ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | |   | |        |  |       ***| |  ||  |    ***          |  |      |  | ***                             | |           | |             | |          | |             |  | |      |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..                           | |   ***        |  |        *** |  ||  |                 |  |      |  |                                 ***           | |             ***          ***             |  | |      |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..                           ***              ****        *** ********                 ****      ****                                               ***                                          ******      ****            
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                                                                                                                                                                             

   New search    4jzj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors