triangle PDBeMotif: 4jgv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Mon, Mar 4, 2013
Title crystal structure of human nur77 ligand-binding domain in co thpn
Authors A.LI, F.LI, H.CHEN, Q.WU, Q.ZHANG, T.LI, W.WAN, X.TIAN, Y.WAN, Y.XING
Method X-RAY DIFFRACTION (resolution: 3.01Å)
PDBe Citation   
Small molecules:    search T94 T94 binding statistics T94   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  GOL 607A  ..          ** ***                                                                            *                                                                                         ..GOL ..  ..  ..                                               
JMol viewer RasMol script viewer  GOL 606A  ..          || |||                                                                            |                                            *                                            ..GOL ..  ..  ..                                               
JMol viewer RasMol script viewer  GOL 605A  ..          || |||                                                                            |                                            |                                            ..GOL ..  ..  ..                   **                          
JMol viewer RasMol script viewer  GOL 604A  ..          || |||                                                                            |  **                                        |                                            ..GOL ..  ..  ..                   ||                          
JMol viewer RasMol script viewer  GOL 603A  ..          || |||                                                                            |  ||                         *              |                                            ..GOL ..  ..  ..                   ||                          
JMol viewer RasMol script viewer  GOL 602A  ..          || |||                                                                            |  **                         |      *       |                                            ..GOL ..  ..  ..                   ||                          
JMol viewer RasMol script viewer  T94 601A  ..          || |||                                                                            |  ||                         |      | *     |      *  ** **              *               ..T94 ..  ..  ..   *  *            ||                          
sec str:  ..hhhhhhhhhhhhhh..hhhhh................hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh... ...........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh...
sequence :  ..ANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVA... ..EP..PA..LSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532         ... ..545..548..552       562       572       582       592    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||  ||    |  |  |^**|||| |           | |                   |  | ||| ||  |  |   |         ||  | | |||    | |  |  ||     |  ||       |  |      |   | |  |^**  |                         ..PS00005..  ..  ..   |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||  ||    |  |  || ||||| |           | |                   |  | ||| |^***  |   |         ||  | | |||    | |  |  ||     |  ||       |  |      |   | |  |  |  |                         ..PS00006..  ..  ..   |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..||  ||    |  |  || ||||| |           | |                   |  | ||| **********************|  | | |||    | |  |  ||     |  ||       |  |      |   | |  |  |  |                         ..PS00029..  ..  ..   |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||  ||    |  |  || ||||| |           | |                   |  | ||| |      |   |         ||  | | |||    | |  *****     *****       |  |      |   | |  |  |  |                         ..alphabetamotif..  ..  ..   |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..||  ||    |  |  || ||*** |           ***                   |  | ||| |      |   |         ||  | | |||    | |  |  |      |  |        |  |      |   | |  |  |  |                         ..asxturn..  ..  ..   |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..||  ||    ****  ****| ****                                 **** ||| |      |   |         ||  | ****|    | |  ****      ****        |  |      |   | |  |  |  |                         ..betaturn..  ..  ..   **** |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..||  ||           |  | |  |                                 |  | ||| |      |   |         ||  |   | |    | |                        |  |      |   | |  |  |  |                         ..gammaturn..  ..  ..        |   |              ||||        | | |***
search RasMol script viewer Motif-ligand binding stats  nest ..||  ||           |  | |  |                                 |  | *** |      |   |         ||  |   ***    ***                        |  |      |   | |  |  |  |                         ..nest..  ..  ..        |   |              ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..||  ||           **** ****                                 ****  ****      |   |         |****          | |                        ****      |   | ****  ****                         ..niche..  ..  ..        |   |                          | ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..******                                                                     *****         *****          | |                                  *****                                    ..ststaple..  ..  ..        *****                          *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                        ***                                                                           ..stturn..  ..  ..                                               

chain B : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  GOL 601B  ..          *   **                ..                                                     *   *                                                                                        ..GOL ..                                                
JMol viewer RasMol script viewer  GOL 605A  ..          |   ||                ..                                                     |   |                                                                                        ..GOL ..                                                
sec str:  ...hhhhhhhhhhhh...hhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh... ........hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh...
sequence :  ..ANLLTSLVRAHLDSGPSTAKLDYSKFQELVLP..KEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAV... ..CLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..362       372       382         ..397       407       417       427       437       447       457       467       477       487       497       507       517       527       537   ... ..551       561       571       581       591     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||  ||    || || |^**| |  |      ..  | |         |  |      |  | ||| ||  |  |   |         ||  | | |||    | |  |  |                   | |||    |   | |  |^**  |                        ..PS00005..    |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||  ||    || || || || |  |      ..  | |         |  |      |  | ||| |^***  |   |         ||  | | |||    | |  |  |                   | |||    |   | |  |  |  |                        ..PS00006..    |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..||  ||    || || || || |  |      ..  | |         |  |      |  | ||| **********************|  | | |||    | |  |  |                   | |||    |   | |  |  |  |                        ..PS00029..    |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  asxturn ..||  ||    || || || || |  |      ..  ***         |  |      |  | ||| |      |   |         ||  | | |||    | |  |  |                   | |||    |   | |  |  |  |                        ..asxturn..    |  | |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..||  ||    ****| ****| ****      ..              ****      **** ||| |      |   |         ||  | ****|    | |  ****                   ****|    |   | |  |  |  |                        ..betaturn..    **** |   |              ||||        | | || |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..||  ||     |  |  |  | |  |      ..                        |  | ||| |      |   |         ||  |   | |    | |                           | |    |   | |  |  |  |                        ..gammaturn..         |   |              ||||        | | |***
search RasMol script viewer Motif-ligand binding stats  nest ..||  ||     |  |  |  | |  |      ..                        |  | *** |      |   |         ||  |   ***    ***                           ***    |   | |  |  |  |                        ..nest..         |   |              ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..||  ||     ****  **** ****      ..                        ****  ****      |   |         |****          | |                                  |   | ****  ****                        ..niche..         |   |                          | ****  
search RasMol script viewer Motif-ligand binding stats  ststaple ..******                          ..                                        *****         *****          | |                                  *****                                   ..ststaple..         *****                          *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ..                                                                     ***                                                                          ..stturn..                                                

   New search    4jgv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors