triangle PDBeMotif: 4ivz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Wed, Jan 23, 2013
Title a y37f mutant of c.esp1396i bound to its highest affinity op site om
Authors G.G.KNEALE, J.E.MCGEEHAN, R.N.A.MARTIN
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,E,F sequence:
GSHMESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
HD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : REGULATORY PROTEIN
sec str:  ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhh....hhhhhhhhhhhh.
sequence :  ..ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
seq num:  ..2         12        22        32        42        52        62        72    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|               | ||||  |    | || |  || | |||^***| |  |  || ||| |  |  |||  |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|               | ||||  |    | || |  || | |||  ^** |  |  || ||| |  |  |||  |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..*               | |||^***    ^*** |  ^*** |||  |   |  |  || ||| |  |  |||  |
search RasMol script viewer Motif-ligand binding stats  PS00008 ..                | ||||  |    | || |   ^*****|  |   |  |  ^***** |  |  |||  |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | ||||  |    | || |       | |  |   |  ***** ||  |  *****|  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | ||||  |    | |***       | |  |   |  |  || ||  |  |  | |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ****|****    | |          | |  |   |  ****| |****  **** ****
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***        ***          ***  |   |      ***               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                               *****                        

chain B : REGULATORY PROTEIN
sec str:  ...hhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhh.
sequence :  ..ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
seq num:  ..2         12        22        32        42        52        62        72    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..||  |  ||         | ||  |    | ||  | || |  | ^***|     |||||| |      || ||| 
search RasMol script viewer Motif-ligand binding stats  PS00005 ..||  |  ||         | ||  |    | ||  | || |  |   ^**     |||||| |      || ||| 
search RasMol script viewer Motif-ligand binding stats  PS00006 ..*|  |  ||         | |^***    ^***  | ^***  |           |||||| |      || ||| 
search RasMol script viewer Motif-ligand binding stats  PS00008 .. |  |  ||         | |        | ||  |  ^*****           ||^*****      || ||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  *****         | |        | ||  |                   || |||        ****** 
search RasMol script viewer Motif-ligand binding stats  betaturn .. *******          | |        | |****                   |****|        *****  
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***        ***                       |  ***               
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                       ******               

chain C : DNA (5'-D(*AP*TP*GP*TP*AP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*GP*AP*CP*A)
sec str:  .....................
sequence :  ..ATGTAGACTATAGTCGACA
seq num:  ..1         11       

chain D : DNA (5'-D(*TP*TP*GP*TP*CP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*TP*AP*CP*A)
sec str:  .....................
sequence :  ..TTGTCGACTATAGTCTACA
seq num:  ..1         11       

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : REGULATORY PROTEIN
sec str:  ...hhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhh..
sequence :  ..ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKH
seq num:  ..2         12        22        32        42        52        62        72     
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|              || ||||  ||   | ||  |||||| |||^***|   |  ||| ||| ||           
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|              || ||||  ||   | ||  |||||| |||  ^**   |  ||| ||| ||           
search RasMol script viewer Motif-ligand binding stats  PS00006 ..*              || |||^***|   ^***  ||^*** |||        |  ||| ||| ||           
search RasMol script viewer Motif-ligand binding stats  PS00008 ..               || ||||  ||   | ||  || ^*****|        |  |^***** ||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..               *****|*****   | |********* | |        *****| |*****           
search RasMol script viewer Motif-ligand binding stats  betaturn ..               *****|****    | |********  | |        **** | |****            
search RasMol script viewer Motif-ligand binding stats  nest ..                  ***        ***          ***             ***                

chain F : REGULATORY PROTEIN
sec str:  ...hhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhh.
sequence :  ..ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
seq num:  ..2         12        22        32        42        52        62        72    
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   |   |     |  | | |  ||   | || |  || | |||^***| |  ||||||| |             
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   |   |     |  | | |  ||   | || |  || | |||  ^** |  ||||||| |             
search RasMol script viewer Motif-ligand binding stats  PS00006 ..*   |   |     |  | | ^***|   ^*** |  ^*** |||      |  ||||||| |             
search RasMol script viewer Motif-ligand binding stats  PS00008 ..    |   |     |  | |     |   | || |   ^*****|      |  |||^*****             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |   |     |  | |     |   | || |       | |      *****| |||               
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |   |     |  | |     |   | |***       | |      |  | | |||               
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |   |     **** |     |   | |          | |      **** ****|               
search RasMol script viewer Motif-ligand binding stats  nest ..    |   |        ***     |   ***          ***             ***               
search RasMol script viewer Motif-ligand binding stats  ststaple ..    *****                *****                                              

chain G : DNA (5'-D(*AP*TP*GP*TP*AP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*GP*AP*CP*A)
sec str:  .....................
sequence :  ..ATGTAGACTATAGTCGACA
seq num:  ..1         11       

chain H : DNA (5'-D(*TP*TP*GP*TP*CP*GP*AP*CP*TP*AP*TP*AP*GP*TP*CP*TP*AP*CP*A)
sec str:  .....................
sequence :  ..TTGTCGACTATAGTCTACA
seq num:  ..1         11       

   New search    4ivz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors