triangle PDBeMotif: 4ihb  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein    | release date: Tue, Dec 18, 2012
Title x-ray structure of the canonical c2a domain from human dysfe
Authors K.L.FUSON, R.B.SUTTON
Method X-RAY DIFFRACTION (resolution: 2.04Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search FMT FMT binding statistics FMT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
GSPEFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETM
GRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAAAS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 208A  ..                                                             *                              *                                 
JMol viewer RasMol script viewer  FMT 207A  ..                              ***                            |                              |                                 
JMol viewer RasMol script viewer  FMT 205A  ..        * *                   |||                            |                              |         *               *       
JMol viewer RasMol script viewer  FMT 204A  ..        | |                   |||   *         **             |                              |         |               |       
JMol viewer RasMol script viewer  FMT 203A  ..        | |                   ||| * |         ||  *          |                              |         |               |       
JMol viewer RasMol script viewer  FMT 202A  ..        | |                   ||| | |         ||  |          |                              |     *   |               | *     
JMol viewer RasMol script viewer  FMT 201A  ..        | |                 **||| | |         ||  |          |  *                           |     |   |               | |     
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhhhhh...eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  | |  |          |  |**^*     | |  | |    |||||  | ||       | | | || |       |  |  | | |         |||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  | |  |          |  |         | |  | |    |||||  | ||       | | | || |       |  |  | | |         ^**| | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |||  | |  |          |  |         | |  | |    ***||  ***|       *** | || |       |  |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  | |  |          |  |         | |  | |     | ||  |  |           | || |       |  |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | |  |          ****         | |  | |     ****  |  |           | || |       ****  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |  |                       | |  ***     ***   |  |           | |***          |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ****                       | |                ****           ***             ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 207B  ..          *                                                                                                                   
JMol viewer RasMol script viewer  FMT 206B  ..          |*                                                                                                      * *         
JMol viewer RasMol script viewer  FMT 205B  ..          ||                                                                                            *         **|         
JMol viewer RasMol script viewer  FMT 204B  ..          ||                     **               *                                                     |         |||         
JMol viewer RasMol script viewer  FMT 203B  ..          ||                     *|               **                                                    |         |||         
JMol viewer RasMol script viewer  FMT 202B  ..          ||                **   ||               ||            *                                       |         |||         
JMol viewer RasMol script viewer  FMT 201B  ..          ||                || * *|               ||**          |                                       |         |||         
sec str:  ...eeeeeeeeee.........eeeeeeeee..eeee...eeee...eeeeeeeee..........eeeeeeeee.....eeeeeeeeee.hhhhh....eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  | |  |          |  |**^*     | |  | |    ||| |                |  |             |  | | |        ||||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | |  |          |  |         | |  | |    ||| |                |  |             |  | | |        |^**| | |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  | |  |          |  |         | |  | |    ||| |                |  |             |  | | |        ***** | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | |  |          ****         | |  | |    |****                |  |             |  | | |        ****| | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |  |                       | |  ***    ||| |                |  |             |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ****                       | |         *****                ****             ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 203C  ..                                                                                          *         **                         
JMol viewer RasMol script viewer  FMT 202C  ..                              ***                                                         |         ||                         
JMol viewer RasMol script viewer  FMT 201C  ..                              |||     *  * ***                                            |         ||                         
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhh......eeeeeeeee.....eeeeeeeeeeeee..
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  |               |  |**^*     | |  | |    | |                 ||| || |          |  | |||         |||| | |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  |               |  |         | |  | |    | |                 ||| || |          |  | |||         ^**| | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  |               |  |         | |  | |    | |                 ||| || |          |  | |||          | | | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |               ****         | |  | |    | |                 |****| |          |  ****|          | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                            | |  | |    | |                 *** || |          |  | | |          | | | |           
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***    | |                  |  |***          |  | ***          *** ***           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |         ***                  *******          ****                  | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***           

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 212D  ..                                                                                                       *                        
JMol viewer RasMol script viewer  FMT 211D  ..                            ****                                                                       |                        
JMol viewer RasMol script viewer  FMT 210D  ..                            |**|                                                                       |                        
JMol viewer RasMol script viewer  FMT 209D  ..                            *|||                                   *                                   |                        
JMol viewer RasMol script viewer  FMT 208D  ..                            |||| *                                 |                                   |                        
JMol viewer RasMol script viewer  FMT 207D  ..                            |||| |**               *               |                                   |                        
JMol viewer RasMol script viewer  FMT 206D  ..                            ||||***|               |               |                                   |                        
JMol viewer RasMol script viewer  FMT 205D  ..                            ||||||||               |               |                                   |                        
JMol viewer RasMol script viewer  FMT 204D  ..                            |||||||| *         *** |               |                                   |                        
JMol viewer RasMol script viewer  FMT 203D  ..                            ||||||*| |         ||| **              |                                   |                        
JMol viewer RasMol script viewer  FMT 202D  ..                            ||||||*| |         ||| |***            |                                   |                        
JMol viewer RasMol script viewer  FMT 201D  ..                            |||***|| |         ||| ||||            |                                   |                        
sec str:  ...eeeeeeeeee...........eeeeeeee..eeee...ee.....eeeeeeeee..........eeeeeeee........eeeeeeee..hhhhh...eeeeeeeee.....eeeeeeeeeeeeee.
sequence :  ..EFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAA
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                  | |        |  |**^*          | |           |  |       | |    | |          |  | |||        ||||| | |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  | |        |  |              | |           |  |       | |    | |          |  | |||        |^**| | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  | |        |  |              | |           |  |       | |    | |          |  | |||        *** | | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  | |        ****              | |           |  |       | |    | |          |  ****|          | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |                          | |           |  |       ***    | |          |  | | |          | | | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                  | |                          ***           |  |              ***          |  | ***          *** ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                  ***                                        ****              ***          ****                  | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                  ***           

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  CA 207E  ..                  ** *                  *                                                                                     
JMol viewer RasMol script viewer  FMT 206E  ..                  || |                  |                                           **                  *                     
JMol viewer RasMol script viewer  FMT 205E  ..           * *    || |                  |                                           ||                  |        *            
JMol viewer RasMol script viewer  FMT 204E  ..           | |    || |            *     |       *                                   ||                  |        |            
JMol viewer RasMol script viewer  FMT 203E  ..           | |    || |          * |     |       |                                   ||                  |        |            
JMol viewer RasMol script viewer  FMT 202E  ..           | |    || |          |**     |       | *                                 ||                  |        |            
JMol viewer RasMol script viewer  FMT 201E  ..           | |    || |          |||     |       | |                                 ||          * *     |        |        *   
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee.......eeeeeeeee.hhh......eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  | | |               **^*     | |  | |        |  |            | |               |  | |||         |||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | | |                        | |  | |        |  |            | |               |  | |||         ^**| | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | | |                        | |  | |        |  |            | |               |  ****|          | | | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  | ***                        | |  | |        |  |            | |               |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***        |  |            | |               |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |             ****            ***               ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain F : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 202F  ..                                                                                          *        **                         
JMol viewer RasMol script viewer  FMT 201F  ..                                                                                          |        |*                 *       
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhhhh....eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  |               |  |**^*     | |  | |    ||| || || |       | ||  || |       |  |  | | |        ||||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  |               |  |         | |  | |    ||| || || |       | ||  || |       |  |  | | |        |^**| | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |||  |               |  |         | |  | |    *** || || |       ***|  || |       |  |  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  |               |  |         | |  | |    ||| || || |          |  || |       |  |  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |               ****         | |  | |    |****| || |          |  || |       ****  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                            | |  | |    ||| || || |          |  || |          |  | | |        | *** | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***    ||| || |***          |  |***          |  | ***        | |   ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |         ***********          ****             **** | |        ***   | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                    ***              ***          

Assembly 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 207B  ..                                                                                                **                        **  
JMol viewer RasMol script viewer  FMT 206B  ..                                                                                               *||                        ||  
JMol viewer RasMol script viewer  FMT 205B  ..                                                                                               *|*                        ||  
JMol viewer RasMol script viewer  FMT 208A  ..                                                             *                              *  |||                        ||  
JMol viewer RasMol script viewer  FMT 207A  ..                              ***                            |                              |  |||                        ||  
JMol viewer RasMol script viewer  FMT 206A  ..             **  ****         |||                            |                              |  |||                        ||  
JMol viewer RasMol script viewer  FMT 205A  ..        * *  ||  ||||         |||                            |                              |  |||    *               *   ||  
JMol viewer RasMol script viewer  FMT 204A  ..        | |  ||  ||||         |||   *         **             |                              |  |||    |               |   ||  
JMol viewer RasMol script viewer  FMT 203A  ..        | |  ||  ||||         ||| * |         ||  *          |                              |  |||    |               |   ||  
JMol viewer RasMol script viewer  FMT 202A  ..        | |  ||  ||||         ||| | |         ||  |          |                              |  |||*   |               | * ||  
JMol viewer RasMol script viewer  FMT 201A  ..        | |  ||  ||||       **||| | |         ||  |          |  *                           |  ||||   |               | | ||  
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhhhhh...eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  | |  |          |  |**^*     | |  | |    |||||  | ||       | | | || |       |  |  | | |         |||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  | |  |          |  |         | |  | |    |||||  | ||       | | | || |       |  |  | | |         ^**| | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |||  | |  |          |  |         | |  | |    ***||  ***|       *** | || |       |  |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  | |  |          |  |         | |  | |     | ||  |  |           | || |       |  |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | |  |          ****         | |  | |     ****  |  |           | || |       ****  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |  |                       | |  ***     ***   |  |           | |***          |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ****                       | |                ****           ***             ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

chain B : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 204C  ..                                                                                                                              
JMol viewer RasMol script viewer  FMT 207B  ..          *                                                                                                                   
JMol viewer RasMol script viewer  FMT 206B  ..          |*                                                                                                      * *         
JMol viewer RasMol script viewer  FMT 205B  ..          ||                                                                                            *         **|         
JMol viewer RasMol script viewer  FMT 204B  ..          ||                     **               *                                                     |         |||         
JMol viewer RasMol script viewer  FMT 203B  ..          ||                     *|               **                                                    |         |||         
JMol viewer RasMol script viewer  FMT 202B  ..          ||                **   ||               ||            *                                       |         |||         
JMol viewer RasMol script viewer  FMT 201B  ..          ||                || * *|               ||**          |                                       |         |||         
JMol viewer RasMol script viewer  FMT 208A  ..          ||                || | ||               ||||          |                   **                  *         |||         
JMol viewer RasMol script viewer  FMT 205A  ..          ||                || | ||               ||||          |                   ||          * *     |         |||         
JMol viewer RasMol script viewer  FMT 204A  ..          ||                || | ||               ||||          |                   ||          | |     |         |||         
JMol viewer RasMol script viewer  FMT 202A  ..          ||                || | ||               ||||          |                   ||          | |     |         |||         
sec str:  ...eeeeeeeeee.........eeeeeeeee..eeee...eeee...eeeeeeeee..........eeeeeeeee.....eeeeeeeeee.hhhhh....eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  | |  |          |  |**^*     | |  | |    ||| |                |  |             |  | | |        ||||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | |  |          |  |         | |  | |    ||| |                |  |             |  | | |        |^**| | |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         |  | |  |          |  |         | |  | |    ||| |                |  |             |  | | |        ***** | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | |  |          ****         | |  | |    |****                |  |             |  | | |        ****| | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  | |  |                       | |  ***    ||| |                |  |             |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         **** ****                       | |         *****                ****             ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

chain C : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 204C  ..                                                                                                                               
JMol viewer RasMol script viewer  FMT 203C  ..                                                                                          *         **                         
JMol viewer RasMol script viewer  FMT 202C  ..                               **                                                         |         ||                         
JMol viewer RasMol script viewer  FMT 201C  ..                               ||     *  * ***                                            |         ||                         
JMol viewer RasMol script viewer  FMT 205A  ..                               ||     |  | |||                                            |         ||                         
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhh......eeeeeeeee.....eeeeeeeeeeeee..
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  |               |  |**^*     | |  | |    | |                 ||| || |          |  | |||         |||| | |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  |               |  |         | |  | |    | |                 ||| || |          |  | |||         ^**| | |           
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  |               |  |         | |  | |    | |                 ||| || |          |  | |||          | | | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |               ****         | |  | |    | |                 |****| |          |  ****|          | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                            | |  | |    | |                 *** || |          |  | | |          | | | |           
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***    | |                  |  |***          |  | ***          *** ***           
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |         ***                  *******          ****                  | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***           

Assembly 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 201E  ..         * *                                                                                                                    
JMol viewer RasMol script viewer  FMT 212D  ..         | |                                                                                           *                        
JMol viewer RasMol script viewer  FMT 211D  ..         | |                ****                                                                       |                        
JMol viewer RasMol script viewer  FMT 210D  ..         | |                |**|                                                                       |                        
JMol viewer RasMol script viewer  FMT 209D  ..         | |                *|||                                   *                                   |                        
JMol viewer RasMol script viewer  FMT 208D  ..         | |                |||| *                                 |                                   |                        
JMol viewer RasMol script viewer  FMT 207D  ..         | |                |||| |*                *               |                                   |                        
JMol viewer RasMol script viewer  FMT 206D  ..         | |                ||||***                |               |                                   |                        
JMol viewer RasMol script viewer  FMT 205D  ..         | |                |||||||                |               |                                   |                        
JMol viewer RasMol script viewer  FMT 204D  ..         | |                |||||||  *         *** |               |                                   |                        
JMol viewer RasMol script viewer  FMT 203D  ..         | |                ||||||*  |         ||| **              |                                   |                        
JMol viewer RasMol script viewer  FMT 202D  ..         | |                ||||||*  |         ||| |***            |                                   |                        
JMol viewer RasMol script viewer  FMT 201D  ..         | |                |||***|  |         ||| ||||            |                                   |                        
sec str:  ...eeeeeeeeee...........eeeeeeee..eeee...ee.....eeeeeeeee..........eeeeeeee........eeeeeeee..hhhhh...eeeeeeeee.....eeeeeeeeeeeeee.
sequence :  ..EFMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTAA
seq num:  ..-1        9         19        29        39        49        59        69        79        89        99        109       119     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..                  | |        |  |**^*          | |           |  |       | |    | |          |  | |||        ||||| | |           
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  | |        |  |              | |           |  |       | |    | |          |  | |||        |^**| | |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  | |        |  |              | |           |  |       | |    | |          |  | |||        *** | | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  | |        ****              | |           |  |       | |    | |          |  ****|          | | | |           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                  | |                          | |           |  |       ***    | |          |  | | |          | | | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                  | |                          ***           |  |              ***          |  | ***          *** ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                  ***                                        ****              ***          ****                  | |           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                  ***           

chain E : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  CA 207E  ..                  ** *                  *                                                                                     
JMol viewer RasMol script viewer  FMT 206E  ..                  || |                  |                                           **                  *                     
JMol viewer RasMol script viewer  FMT 205E  ..           * *    || |                  |                                           ||                  |        *            
JMol viewer RasMol script viewer  FMT 204E  ..           | |    || |            *     |       *                                   ||                  |        |            
JMol viewer RasMol script viewer  FMT 203E  ..           | |    || |          * |     |       |                                   ||                  |        |            
JMol viewer RasMol script viewer  FMT 202E  ..           | |    || |          |**     |       | *                                 ||                  |        |            
JMol viewer RasMol script viewer  FMT 201E  ..           | |    || |          |||     |       | |                                 ||          * *     |        |        *   
JMol viewer RasMol script viewer  FMT 212D  ..           | |    || |          |||     |       | |                                 ||          | **    |        |      * |   
JMol viewer RasMol script viewer  FMT 205D  ..           | |    || |          |||     |     **| |                                 ||          | ||    |        |      | |   
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee.......eeeeeeeee.hhh......eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  | | |               **^*     | |  | |        |  |            | |               |  | |||         |||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  | | |                        | |  | |        |  |            | |               |  | |||         ^**| | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  | | |                        | |  | |        |  |            | |               |  ****|          | | | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  | ***                        | |  | |        |  |            | |               |  | | |          | | | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***        |  |            | |               |  | ***          *** ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |             ****            ***               ****                  | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                                     ***          

chain F : DYSFERLIN
member of: GENE3D:searchG3DSA_2.60.40.150PANTHER:searchPTHR12546/searchPTHR12546_SF35PFAM:searchPF00168PROSITE PROFILES:searchPS50004, SMART:searchSM00239SUPERFAMILY:searchSSF49562UniProt:searchO75923
JMol viewer RasMol script viewer  FMT 202F  ..                                                                                          *        **                         
JMol viewer RasMol script viewer  FMT 201F  ..                                                                                          |       *|*                 * *     
JMol viewer RasMol script viewer  FMT 206E  ..                                                                                          |       |||                 | |     
sec str:  ...eeeeeeeeee...........eeeeeee..eeee..........eeeeeeeee..........eeeeeeee........eeeeeeee.hhhhh....eeeeeeeee.....eeeeeeeeeeeee.
sequence :  ..FMLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYTA
seq num:  ..0         10        20        30        40        50        60        70        80        90        100       110       120   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       |||  |               |  |**^*     | |  | |    ||| || || |       | ||  || |       |  |  | | |        ||||| | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |||  |               |  |         | |  | |    ||| || || |       | ||  || |       |  |  | | |        |^**| | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |||  |               |  |         | |  | |    *** || || |       ***|  || |       |  |  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **|  |               |  |         | |  | |    ||| || || |          |  || |       |  |  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..         |  |               ****         | |  | |    |****| || |          |  || |       ****  | | |        | | | | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         |  |                            | |  | |    ||| || || |          |  || |          |  | | |        | *** | |          
search RasMol script viewer Motif-ligand binding stats  nest ..         |  |                            | |  ***    ||| || |***          |  |***          |  | ***        | |   ***          
search RasMol script viewer Motif-ligand binding stats  niche ..         ****                            | |         ***********          ****             **** | |        ***   | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                         ***                                                    ***              ***          

   New search    4ihb:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors