triangle PDBeMotif: 4i2d  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.31
Classification transferase    | release date: Wed, Nov 21, 2012
Title binary complex of mouse tdt with ampcpp
Authors J.GOUGE, M.DELARUE
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search ZN ZN binding statistics ZN   search NA NA binding statistics NA   search APC APC binding statistics APC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSHHHHHHSSGLVPRGSHMSPSPVPGSQNVPAPAVKKISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLA
FMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMG
FRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITS
PEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEKSGQQEGKGWKA
IRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA NUCLEOTIDYLEXOTRANSFERASE
member of: GENE3D:searchG3DSA_1.10.150.110/searchG3DSA_1.10.150.20/searchG3DSA_3.30.210.10/searchG3DSA_3.30.460.10/searchG3DSA_3.40.50.10190PANTHER:searchPTHR11276/searchPTHR11276_SF21PFAM:searchPF00533/searchPF01909/searchPF10391/searchPF14716/searchPF14791PIRSF:searchPIRSF000817/searchPIRSF501175PRINTS:searchDNAPOLX/searchDNAPOLXTDTPROSITE PATTERNS:searchPS00522, PROSITE PROFILES:searchPS50172, SMART:searchSM00292/searchSM00483SUPERFAMILY:searchSSF47802/searchSSF52113/searchSSF81301/searchSSF81585UniProt:searchP09838
JMol viewer RasMol script viewer  ZN 604A  ..                                                                                                                                                                                                  * *                                                                          ..ZN ..         *                                                                            
JMol viewer RasMol script viewer  APC 603A  ..                                                                                                                                                                                       **  *    *** *                                                     *                    ..APC ..         |              ** *                     *                                    
JMol viewer RasMol script viewer  NA 602A  ..                                                                                                        * *  *                                                                         ||  |    ||| |                                                     |                    ..NA ..         |              || |                     |                                    
JMol viewer RasMol script viewer  MG 601A  ..                                                                                                        | |  |                                                                         ||  |    ||* |                                                     |                    ..MG ..         |              || |                     |                                    
sec str:  ......hhhhh.......hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh......hhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhh...hhhhhhhh.....hhhhhhhhhhhhhhhh.eehhhhhhhhhhhhhhhhhhh...eeeehhhhhh...ee..eeeeee....hhhhhhhhhhhhhhhhhhhh.eeeeeee....................eeeeeeeeee.hhh....... .....eeeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheee....eee....eee...hhhhhhhhh.....hhhhh..
sequence :  ..KISQYACQRRTTLNNYNQLFTDALDILAENDELRENEGSCLAFMRASSVLKSLPFPITSMKDTEGIPCLGDKVKSIIEGIIEDGESSEAKAVLNDERYKSFKLFTSVFGVGLKTAEKWFRMGFRTLSKIQSDKSLRFTQMQKAGFLYYEDLVSCVNRPEAEAVSMLVKEAVVTFLPDALVTMTGGFRRGKMTGHDVDFLITSPEATEDEEQQLLHKVTDFWKQQGLLLYCDILESTFEKFKQPSRKVDALDHFQKCFLILKLDHGRVHSEK... ..GKGWKAIRVDLVMCPYDRRAFALLGWTGSRQFERDLRRYATHERKMMLDNHALYDRTKRVFLEAESEEEIFAHLGLDYIEPWERNA
seq num:  ..149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409        ... ..425       435       445       455       465       475       485       495       505   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*^* ||  **^*                     | | |    |      |  |     | |||| |        |  |    | |      |  |   |||| || |  ||    |  | ||| | | | |||||| |   |       |  |  |   |        |   | |  |     |   | | |  | |   ||||||  |    |   |     ||||||     | ||  |  | |    | |          |  | | |..PS00004.. | |                  |   | |   |          | |  | |   | ||||     |  ||   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | ||  |                        | | |    |      |  |     ^**||| |        |  |    | |      |  |   |^** || |  ||    |  | ||| | | | ^**^** |   |       |  |  |   |        |   | |  |     |   | | |  | |   ||||||  |    |   |     ||||||     | ||  |  ^**    | |          |  | ^**..PS00005.. | |                  |   | |   |          | |  | |   | ^**|     |  ||   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | ||  |                        | | |    |      |  |     ^***|| |        ^***    | |      |  |   | |  || |  ||    |  | ||| | | | ||  |  |   |       |  |  |   |        |   | |  |     |   | | ^*** |   ^***|^***    |   |     ||||||     ^***  |  | |    | |          |  | | |..PS00006.. | |                  |   | |   |          | |  | |   | || |     ^***|   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | ||  |                        | | ^*****      |  |       | || |                | |      |  |   | |  || |  |^*****  | ||| | | | ||  |  |   |       |  |  |   |        |   | |  |     |   | |    | |    || |        |   |     ||||||     | ||  |  | |    | |          |  | | |..PS00008..** |                  |   | |   |          | |  | |   | || |     |   |   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  DNA_POLYMERASE_X ..  | ||  |                        | |             |  |       | || |                | |      |  |   | |  || |  |        | ||| | | | ||  |  |   |       |  |  |   |        |   | |  |     ****^******^*^****** |        |   |     ||||||     | ||  |  | |    | |          |  | | |..PS00522.. | |                  |   | |   |          | |  | |   | || |     |   |   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | ||  |                        | |             |  |       | || |                | |      |  ***** |  || |  |        | ||| | | | ||  |  |   |       |  |  *****        |   | |  |         | |           |  |        |   |     ||||||     | ||  |  | |    | |          |  | | |..asxmotif.. | |                  |   | |   |          | |  | |   | || |     |   |   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | ||  |                        | |             |  |       | || |                | |      |  |     |  || |  |        | ||| | | | ||  |  |   |       |  |               |   | |  |         | |           |  |        |   |     ||||||     | ||  |  | |    | |          |  | | |..asxturn.. | |                  |   | |   |          | |  ***   ***| |     |   |   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..  | ||  |                        | |             |  |       | || |                | |      |  |     |  || |  |        | ||| | | | ||  |  |   |       |  |               |   | |  |         | |           |  |        |   |     ||||**     | ||  |  | |    | |          |  | | |..betabulge.. | |                  |   | |   |          | |           | |     |   |   | |   |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | ||  |                        | |             |  |       | || |                | |      ****     |  || |  |        ****| | | | ||  |  |   |       |  |               |   | |  |         | |           |  |        |   |     ||||       | ||  |  | |    | |          |  | | |..betaturn.. | |                  |   | |   |          | |           | |     |   |   | |   ****   
search RasMol script viewer Motif-ligand binding stats  nest ..  | ||  |                        ***             |  |       | || |                ***      |  |     |  || |  |          *** | | | ||  |  |   |       |  |               |   | |  |         ***           |  |        |   |     ****       | ||  |  | |    | |          |  | | |..nest.. ***                  |   | |   |          ***           ***     |   |   ***          
search RasMol script viewer Motif-ligand binding stats  niche ..  *******                                        ****       ******                         ****     |  *******              | | *******  |   |       ****               |   | ****                       ****        |   |      ***       *******  ***    ***          **** | |..niche..                      |   | |   |                                |   |                
search RasMol script viewer Motif-ligand binding stats  stmotif ..  | |                                                                                               |   |                   ***** |      *****                          |   |                                        |   |                | |      | |                      | |..stmotif..                      |   | *****                                *****                
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |                                                                                               *****                     *****                                     *****                                        *****                | |      | |                      | |..ststaple..                      *****                                                           
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                                                                                                                                                                                                     ***      ***                      ***..stturn..                                                                                      

   New search    4i2d:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors