triangle PDBeMotif: 4hkc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein/peptide    | release date: Mon, Oct 15, 2012
Title 14-3-3-zeta in complex with s1011 phosphorylated integrin al peptide
Authors I.D.CAMPBELL, R.BONET
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKK
QQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEI
SKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGD
EAEAGEGGEN
Chain B sequence:
GFFKRQYKSILQEENRRDSWSYINSKSNDD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 14-3-3 PROTEIN ZETA/DELTA
member of: GENE3D:searchG3DSA_1.20.190.20PANTHER:searchPTHR18860/searchPTHR18860_SF5PFAM:searchPF00244PIRSF:searchPIRSF000868PRINTS:search1433ZETAPROSITE PATTERNS:searchPS00796/searchPS00797, SMART:searchSM00101SUPERFAMILY:searchSSF48445UniProt:searchP63104
JMol viewer RasMol script viewer  GOL 301A  ..                                                                                                                                                                                                          * *                        
sec str:  ..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.
sequence :  ..DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            | |||       | | |||||  || ||         | | | ||||  | ||| ||                            |  |   | ^*** |      |       | |  ||  ||                 ||||||  |    |   ^***     | |     |   |  |     | |||| |||| |        ^*** ||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..            | |||       | | |||||  || ||         | | **^*||  | ||| ||                            |  |   |  ||  |      |       | |  ||  ||                 ||||||  |    |    |       | |     |   |  |     | |||| |||| |         |   ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | |||       | | |||||  || ||         | |    ^**  | ||| ||                            |  |   |  ||  |      |       | |  ||  ||                 ^**|||  |    |    |       | |     |   |  |     | |||| ^**| |         |   ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | |||       | ^***|||  ^***|         | |    ||   ^***| ||                            ^***   |  |^***      |       | |  ||  ||                 ^***||  |    |    |       | |     |   ^***     | ^*** ^*** |         |   ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | |||       |   | |||  ||  |         | |    ||   | | | ||                                   |  |          ********^ |  ||  ||                  |  ||  |    |    |       | |     |   |        |  ||   |   |         |   ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |||       |   | |^*****  |         | ^*****|   | | | ||                                   |  |                    |  ||  ||                  |  ||  |    ^*****       | |     |   |        |  ||   |   |         |   ||
search RasMol script viewer Motif-ligand binding stats  1433_1 ..            | |||       |   | | |  |   ***********       |   | | | ||                                   |  |                    |  ||  ||                  |  ||  |                 | |     |   |        |  ||   |   |         |   ||
search RasMol script viewer Motif-ligand binding stats  1433_2 ..            | |||       |   | | |  |   |                 |   | | | ||                                   |  |                    |  ||  ||                  |  ||  |                 | |     |   |        |  ||   ********************
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |||       |   | | |  |   |                 |   | | | ||                                   |  |                    |  |*****                  |  ||  |                 | |     |   |        |  ||   |   |         |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            ****|       |   | | |  |   |                 |   | | | ||                                   |  |                    |  |****                   |  |****                 | |     |   |        |  ||   |   |         |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..              ***       |   | ***  |   |                 |   | | | ||                                   |  |                    |  |                       |  ||  |                 ***     |   |        |  ||   |   |         |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..                        |   |      |   |                 |   | | ****                                   ****                    ****                       ********                         |   |        ****|   |   |         |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        |   |      *****                 |   | |   |                                                                                                                        |   |            *****   |         |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****                            ***** *****                                                                                                                        *****                *****         ***** 

chain B : ALPHA-4 INTEGRIN DERIVED PHOSPHORYLATED PEPTIDE
member of: GENE3D:searchG3DSA_1.20.5.930PANTHER:searchPTHR23220/searchPTHR23220_SF78PRINTS:searchINTEGRINAPROSITE PATTERNS:searchPS00242, UniProt:searchP13612
sec str:  ..........
sequence :  ..KRQYKSIL
seq num:  ..1006    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |    
search RasMol script viewer Motif-ligand binding stats  niche .. ***    

   New search    4hkc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors