triangle PDBeMotif: 4h3t  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cell invasion    | release date: Fri, Sep 14, 2012
Title crystal structure of crispr-associated protein cse1 from acidimicrobium ferrooxidans
Authors A.JOACHIMIAK, K.MICHALSKA, L.STOLS, MIDWEST CENTER FOR, S.CLANCY, STRUCTURAL GENOMICS (MCSG)
Method X-RAY DIFFRACTION (resolution: 2.03Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SNAMEPEMHFDLSSEPWLPVRFRDGRRSEVSLRDIFVLAHTIVGFDVDFPTLEPALLRLVLALAYRILRGPKDDAEWGRL
WEADRFSEDAIDDYFARWRHRFDLFSKEFPFFQVADLEPAGKGGVKTANSLVAYAPSGNNVPVFTPITDRTELALSPAEA
ARWLVERHAFGSASDKTGAKGNPKVKGGKDTPAIGYLAWIGFVAPVGQTLRETLLLNLVPWQYRNLIRGGEDDVPAWERD
PLGPTRVMRAPDGVCDLFTWQGRRIRLFPERRGDAIVVPRVLICAGDEVDRRAARDVDPHVGWRMESRRGAEVSYVPLRA
RPGQQVWRGLSSVLALGAEEQRAGVLSFVEGLQSRGIALVSLLVTSAKFGNMSTTLDDLAYDRLDTPLAVLNQEDPAAAT
VAIDAVTFAAHAAQALGYVAEARYLSYDLSFHEESKRHRVPEGKAALAKAARSALAEEIYGRLDAPYRHFLTGLANIDDL
ERPRAEWAALVEAVARDLASRELAQLAPAQAFAGVAGEDRFRRMLARARNEFSPSDSPEKGAA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CRISPR-ASSOCIATED PROTEIN, CSE1 FAMILY
member of: PFAM:searchPF09481TIGRFAMS:searchTIGR02547UniProt:searchC7LYW9
JMol viewer RasMol script viewer  GOL 602A  ..                                                                                                                                     ..                                          ** *  *                                                                                        ** *                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  GOL 601A  ..                                                                                                *          **                        ..                                          || |  |                                         **                  *                          || |                                                                                                                                                                                                                                                   
sec str:  ...............eeeee....eeeehhhhhhhh...eeee.....hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh...hhhhhhhhhhhhhhhh.......................ee.hhhh............hhhhhhhhhhhhhhhh.......................hhhhhh.eeeee..hhhhhhhhhh................hhhhh........ee...hhhhhh....eeeeeeeeee..eeeeeeeeeee..eehhhhhhhhh....eeeeeee..eeeeee.......hhhhhhhhhhh....ee.hhhhhhhhhhhhhh..eeeeeeeeeeee....eeeeeeeeeeeeehhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee.....hhhhhee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..EPEMHFDLSSEPWLPVRFRDGRRSEVSLRDIFVLAHTIVGFDVDFPTLEPALLRLVLALAYRILRGPKDDAEWGRLWEADRFSEDAIDDYFARWRHRFDLFSKEFPFFQVADLEPAGKGGVKTANSLVAYAPS..TELALSPAEAARWLVERHAFGSASDKTGAKGNPKVKGGKDTPAIGYLAWIGFVAPVGQTLRETLLLNLVPWQYRNLIRGGEDDVPAWERDPLGPTRVMRAPDGVCDLFTWQGRRIRLFPERRGDAIVVPRVLICAGDEVDRRAARDVDPHVGWRMESRRGAEVSYVPLRARPGQQVWRGLSSVLALGAEEQRAGVLSFVEGLQSRGIALVSLLVTSAKFGNMSTTLDDLAYDRLDTPLAVLNQEDPAAATVAIDAVTFAAHAAQALGYVAEARYLSYDLSFHEESKRHRVPEGKAALAKAARSALAEEIYGRLDAPYRHFLTGLANIDDLERPRAEWAALVEAVARDLASRELAQLAPAQAFAGVAGEDRFRRMLARARNEFSP
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122          ..148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518       528 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      ||| |        | ||   | |||  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |  ||       |  || |||| |  |  |           |  |        | ||          || ||  |  |  |  |   | |         | | |||  |       ||||                   |  | ||    ||||| |  |     |  |    |  | ||||  |      |  |    | |        | | |^***| ||          |  | ||||  |             |  | | || ||  | || | | ||                                   |  |                         |  ||  |                      | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ||| |        | ||   ^**||  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |  ||       |  || ^**| |  |  |           |  |        ^**|          || ||  |  |  |  |   | |         | | |||  |       ||||                   |  | ||    |^**| |  |     |  |    |  | ||||  |      |  |    | |        ^** |  ||| ||          |  | ||||  |             |  | | || ||  | || | ^**|                                   |  |                         |  ||  |                      | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ||| |        | ||   ^***|  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     ^***|       |  |^*** | |  |  |           |  |        ^***          || ||  |  |  |  |   | |         | | |||  |       ||||                   |  | ||    ||||| |  |     |  |    |  | ||||  |      ^***    | |            |  |^***|          |  | ||||  |             |  | | || ||  | ^*** |  |                                   |  |                         |  ||  |                      ^*
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      ||| |        | ||   |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | |||  |       ||||                   |  | ||    ||*******^     |  |    |  | ||||  |              | |            |  | | ||          |  | ||||  |             |  | | || ||  | ||   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ||| |        | ||   |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     ^*****| ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | |||  |       ||||                   |  | ||    || |^*****     |  |    |  | ||||  |              | |            ^***** ||          |  | ||||  |             |  | | || ||  | ||   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      ||| |        ^***   |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | ||^***       ||||                   |  | ||    || || |        |  |    |  | ||||  |              | |            |  | | ||          |  | ||||  |             |  | | || ||  | ||   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  RGD ..      ||| |        | |    |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | ||           ***|                   |  | ||    || || |        |  |    |  | ||||  |              | |            |  | | ||          |  | ||||  |             |  | | || ||  | ||   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||| |        | |    |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      *****  |  |  |  |   | |         | | ||            | |                   |  | ||    || || |        |  |    |  | ||||  |              | |            |  | | ||          |  | ||||  |             |  | | *****  | ||   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  asxturn ..      *** |        | |    |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | ||            | |                   |  ***|    || || |        |  |    |  | ||||  |              | |            |  | | ||          |  ******  |             |  | | || ||  ***|   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  |        | |    |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | ||            | |                   |  |  |    ** || |        |  |    |  | ||||  |              | |            |  | | **          |  |   |   |             |  | | || ||  |  |   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       |  |        | |    |   |  || ||                         | |         |  |   |   |      ||||||  |   |  ||  |     | |  || ||     ..     |   |       |  || || | |  |  |           |  |                      || ||  |  |  |  |   | |         | | ||            | |                   |  |  |       || |        |  |    |  | ||||  |              | |            ******             |  |   |   |             |  | | || ||  |  |   |  |                                   |  |                         |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |        | |    |   |  ****|                         | |         |  |   |   |      *****|  |   ****|  |     | |  *****     ..     |   |       |  || || | |  |  |           |  |                      ****|  |  |  |  |   | |         | | ||            | |                   |  |  |       ****        |  |    **** ||||  |              | |               | |             |  |   |   |             **** ******|  |  |   |  |                                   |  |                         |  |****                        
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |        ***    |   |   |  |                         ***         |  |   |   |        |  |  |   |  ||  |     ***   |  |     ..     |   |       |  || || | |  |  |           |  |                       |  |  |  |  |  |   | |         | | ||            | |                   |  |  |        | |        |  |         ****  |              ***               ***             |  |   |   |                     |  |  |  |   |  |                                   |  |                         |  |                            
search RasMol script viewer Motif-ligand binding stats  niche ..       ****               |   |   ****                                     ****   |   |        *******   ********     ***   ****     ..     |   |       ****| |*** *******           ****                       ****  ****  ****   ***         | ****            ***                   *******        ***        ****          ******                                                ****   |   |                     ****  ****   ****                                   ****                         ****                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                          *****                                                   *****                                              ..     *****           | |                                                                                |   |                                                                                                                                        |   |                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                     ..                     | |                                                                                *****                                                                                                                                        *****                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                     ..                     ***                                                                                                                                                                                                                                                                                                                                                                        

   New search    4h3t:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors