triangle PDBeMotif: 4h3e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Thu, Sep 13, 2012
Title crystal structure of a putative iron superoxide dismutase fr trypanosoma cruzi bound to iron
Authors SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE (S
Method X-RAY DIFFRACTION (resolution: 2.25Å)
PDBe Citation   
Small molecules:    search FE2 FE2 binding statistics FE2
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MAHHHHHHMLRRAVNISIARGRMALMSYATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLN
ALAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSFESAVTAQFGSVEQFKDAFVQAGVN
NFGSGWTWLCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAI
K
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPEROXIDE DISMUTASE
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF16PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchQ4DCQ3
JMol viewer RasMol script viewer  FE2 301A  ..                                       *                                                  *                                                                                   *   *                                   
sec str:  ........................hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee.hhhh..eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..YATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLNALAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSFESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTWLCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAIK
seq num:  ..20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || ||  |  |          |  | |  || |  |  ||             |||||| ||  ||   |  | |            ^***|| |||  |                |   |       |  | |    |   | | |      ^*** | || |||  ||  | | |  |             |||||| | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||  |  |          |  | |  |^**  |  ||             |||||| ||  ||   |  | |                || |||  |                |   |       |  | |    |   | ^**        || | || |||  ||  | | |  |             |||||| | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|  |  |          |  | |  |  |  |  ||             ||^*** |^***|   |  | |                || |||  |                |   |       |  | |    |   | |          || | || |||  ||  | | |  |             ||^*** | |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |  |  |  |          |  | |  |  ******^|             |||||| ||   |   |  | |                || |||  |                |   |       |  | |    |   | |          || | || |||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |  |          |  | |  |     |   |             |||||| ||   |   |  | |                || |||  |                |   |       |  | ^*****   | |          || ^*****||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   |  |  |  |          |  | |  |     |   |             |********   |   |  | |                || |||  |                |   |       |  |          | |          || | || |||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  | |                || |||  |                |   |       |  |          | |          || | || |||  ||  ^***^***             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  | |                || |||  |                |   |       |  |          | |          || | || |||  ||  | |                  *****| | |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  | |                || |||  |                |   |       |  |          | |          || | || |||  ||  | |                  || ||*****         
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  ***                || |||  |                |   |       |  |          ***          || | || |||  ||  | |                  || ||***           
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  |                  || |||  |                |   |       |  |                       || | || |||  **  | |                  || ||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |  |          **** |  |     |   |             ****|| ||   |   |  |                  ****|****                |   |       |  |                       **** *****|      | |                  ****|              
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |  |               |  |     |   |               | || ||   |   |  |                   |  |                    |   |       |  |                        | |    ***      | |                   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  ****               ****     |   |               ******|   |   ****                   ****                    |   |       ****                        ***             ***                   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                     |   |                     *****                                                  *****                                                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     *****                                                                                                                                                                            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SUPEROXIDE DISMUTASE
member of: GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF16PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchQ4DCQ3
JMol viewer RasMol script viewer  FE2 301B  ..                                       *                                                  *                                                                                   *   *                                   
sec str:  ........................hhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeee.hhhh..eeeeeee...hhhhhh.eeeeeee.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..YATLPDLLKPSGAPAELPKLGFNWKDGCAPVFSPRQMELHYTKHHKAYVDKLNALAGTTYDGKSIEEIILAVANDAEKKGLFNQAAQHFNHTFYFRCITPNGKAMPKSFESAVTAQFGSVEQFKDAFVQAGVNNFGSGWTWLCVDPSNKNQLVIDNTSNAGCPLTKGLRPVLAVDVWEHAYYKDFENRRPDYLKEIWSVIDWEFVAKMHAQAIK
seq num:  ..20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  || ||  |  |          |  | |  || |  |  ||             |||||| ||  ||   |  | |||        | ^***|| |||  |                |   |       |  | |    |   | | |      ^*** | || |||  ||  | | |  |             |||||| | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  || ||  |  |          |  | |  |^**  |  ||             |||||| ||  ||   |  | |||        |   | || |||  |                |   |       |  | |    |   | ^**        || | || |||  ||  | | |  |             |||||| | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***|  |  |          |  | |  |  |  |  ||             ||^*** |^***|   |  | |||        |   | || |||  |                |   |       |  | |    |   | |          || | || |||  ||  | | |  |             ||^*** | |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |  |  |  |          |  | |  |  ******^|             |||||| ||   |   |  | |||        |   | || |||  |                |   |       |  | |    |   | |          || | || |||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |  |  |          |  | |  |     |   |             |||||| ||   |   |  | |||        |   | || |||  |                |   |       |  | ^*****   | |          || ^*****||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   |  |  |  |          |  | |  |     |   |             |********   |   |  | |||        |   | || |||  |                |   |       |  |          | |          || | || |||  ||  | | |  |             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  | |||        |   | || |||  |                |   |       |  |          | |          || | || |||  ||  ^***^***             || ||| | |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  | |||        |   | || |||  |                |   |       |  |          | |          || | *****|  ||  | |                  || ||| | |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  *****        |   | || |||  |                |   |       |  |          | |          || | || |||  ||  | |                  || ||*****         
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  ***|         |   | || |||  |                |   |       |  |          ***          || | || |||  ||  | |                  || ||***           
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  |  |  |          |  | |  |     |   |             | |||| ||   |   |  |  |         |   | || |||  |                |   |       |  |                       || | || |||  **  | |                  || ||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |  |  |          **** |  |     |   |             ****|| ||   |   |  ****         |   | ****|****                |   |       |  |                       **** *****|      | |                  ****|              
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |  |  |               |  |     |   |               | || ||   |   |  |            |   |  |  |                    |   |       |  |                        | |    ***      | |                   |  |              
search RasMol script viewer Motif-ligand binding stats  niche ..   ****  ****               ****     |   |               ******|   |   ****            |   |  ****                    |   |       ****                        ***             ***                   ****              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                     |   |                     *****                   |   |                          *****                                                                                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     *****                                             *****                                                                                                                          

   New search    4h3e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors