triangle PDBeMotif: 4gfx  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Sat, Aug 4, 2012
Title crystal structure of the n-terminal domain of txnip
Authors J.HWANG, M.H.KIM
Method X-RAY DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VAAIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPT
GENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : THIOREDOXIN-INTERACTING PROTEIN
member of: PANTHER:searchPTHR11188/searchPTHR11188_SF14PFAM:searchPF00339SUPERFAMILY:searchSSF81296UniProt:searchQ9H3M7
JMol viewer RasMol script viewer  GOL 801A  ..                                   **                                                                                             *                    
sec str:  .....eeeeeeee...........eeeeeeeeee...eee.eeeeeeeeee.eeee..eeeee.....eeeeee.............eee.....eeeeeeee......eeee...ee.eeeeeeeeeee..eeeeeeeeee....eee....
sequence :  ..VAAIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTP
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |||      |  |  |  |                                 |    |       |     |  ||  |      |  |                 ^**                       ^**        |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |||      |  |  |  |                                 |    ********^     |  ||  |      |  |                                                      |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |||      |  |  |  |                                 ^*****             |  ||  |      |  |                                                      |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |**      |  |  |  |                                                    |  ||  |      |  |                                                      |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..****        |  |  ****                                                    ********      |  |                                                      |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..            ****  ****                                                    ********      ****                                                      **** 

   New search    4gfx:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors