triangle PDBeMotif: 4ey4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Tue, May 1, 2012
Title crystal structure of recombinant human acetylcholinesterase state
Authors E.GARY, F.BURSHTEYN, J.CHEUNG, J.HEI, J.LOVE, M.CASSIDY, M.FRANKLIN, M.RUDOLPH
Method X-RAY DIFFRACTION (resolution: 2.16Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search FUC FUC binding statistics FUC   search NO3 NO3 binding statistics NO3   search PE8 PE8 binding statistics PE8   search EDO EDO binding statistics EDO
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP22303
JMol viewer RasMol script viewer  NO3 607B  ..                                                                                                                                                                                                                                                               ..NO3 ..                                                                                                                                                                                                                                      ..NO3 ..                                             
JMol viewer RasMol script viewer  EDO 605A  ..                                                                                                                                                                                                                                                               ..EDO ..                                                                                                                                                                                                                                      ..EDO ..                            *   *   *        
JMol viewer RasMol script viewer  EDO 604A  ..                                                                                                                                                                                                                                                               ..EDO ..                                                                                                                     ***  **    **  *                                                                                                 ..EDO ..                            |   |   |        
JMol viewer RasMol script viewer  NAG 603A  ..                                                                                                                                                                                                                                                               ..NAG ..                                                                               ***                                   |||  ||    ||  |                                                                                                 ..NAG ..                            |   |   |        
JMol viewer RasMol script viewer  NAG 602A  ..                                                                                                                                                                                                                                                               ..NAG ..                                                                               ||**  *                               |||  ||    ||  |                                                                                                 ..NAG ..                            |   |   |        
JMol viewer RasMol script viewer  FUC 601A  ..                                                                                                                                                                                                                                                               ..FUC ..                                                                               ||||  |                               |||  ||    ||  |                                                                                                 ..FUC ..                            |   |   |        
sec str:  ...hhh.eeee..eeee.eee......eeeeeeee.....hhhhh............eee......ee..........hhhhhh......ee....eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee..........eehhhhhhhhhhhhhhh...... ...hhhhhhhhhh.hhhhhhhhhhhhh............ee.......hhhhhhhh......eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.......... .............eeeee.....eeee..hhhhhhhhhhhhhhhhhh
sequence :  ..EDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCP... ..NDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEPRD... ..PQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254  ... ..265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       ... ..498       508       518       528       538  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | ||| |        | |||  || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||| || ||       | |           |  | |  |     | |              || |||| ||      |||      |  |   |  |        |  ||  | |    || ||     ||| ..PS00001..^***    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || |^*** |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    |||  |  |^*** ||               | | |    ..PS00001..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  | ||| |        | |||  || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||| || ||       | |           |  | |  |     | |              || |||| ||      |||      |  |   |  |        |  ||  | |    |**^*     ||| ..PS00004..| ||    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    |||  |  | ||  ||               | | |    ..PS00004..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | ^** |        | |||  || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||| || ||       | |           |  | |  |     | |              || |||| ||      |||      |  |   |  |        |  ||  | |    |         ||| ..PS00005..| ||    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    |||  |  | ||  ||               | | |    ..PS00005..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |  |  |        | |||  || ||   |   | || |         |    |             |  |   |  |  |  |||| |     |                |||||||^*** ||       | |           |  | |  |     | |              || |||| ||      |||      |  |   |  |        |  ||  | |    |         ||| ..PS00006..| ||    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| ^***|  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    |||  |  | |^***|               | | |    ..PS00006..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  |  |  |        | |||  || ||   |   | || |         |    |             |  |   |  |  ********^     |                |||||||  || ||       | |           |  | |  |     | |              || |||| ||      |||      |  |   |  |        |  ||  | |    |         ||| ..PS00007..| ||    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |   |  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    |||  |  | ||   |               | | |    ..PS00007..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |  |  |        | ^*****| ^*****   | || |         ^*****             |  |   |  |     ||||       |                ^*****|  || ||       | |           |  | |  |     | |              || |^*****      |||      |  |   |  |        |  ||  | ^*****         |^**..PS00008..****    |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |   |  ^*****  ||   |   ||  || ||| |                              | |      | | |  | |    ^*****|    |||  |  | ||   |               | | |    ..PS00008..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 ..  |  |  |  |        | |||   |  |       | || |                            |  |   |  |     ||||       |                ||||| |  || ||       | |           |  | |  |     | |              || *************^**      |  |   |  |        |  ||  |                | | ..PS00122..| |     |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |   |       |  ||   |   ||  || ||| |                              | |      | | |  | |      |||||    |||  |  | ||   |               | | |    ..PS00122..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 ..  |  |  |  |        | |||   |  |       | || |                            |  |   |  |     |**^********                ||||| |  || ||       | |           |  | |  |     | |              || |||| |       ||       |  |   |  |        |  ||  |                | | ..PS00941..| |     |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |   |       |  ||   |   ||  || ||| |                              | |      | | |  | |      |||||    |||  |  | ||   |               | | |    ..PS00941..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |  |  |        | |||   |  |       | || |                            |  |   |  |     | |                         ||||| |  || ||       | |           |  | |  |     | |              || |||| |       ||       |  |   |  |        |  ||  |                | | ..asxmotif..| |     |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || ||||| |   |       |  ||   |   ||  |***** |                              | |      | | |  | |      |||||    |||  |  | ||   |               | | |    ..asxmotif..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |  |  |        | |||   |  |       | || |                            |  |   |  |     | |                         ||||| |  || ||       | |           |  | |  |     | |              || |||***       ||       |  |   |  |        |  ||  |                | | ..asxturn..***     |  |         |  |   |  |       | |    |   ||  |||| |         |        |  || |***| |   |       |  ||   |   ||  |***|  |                              | |      | | |  | |      |||||    |||  |  | ||   |               | | |    ..asxturn..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |  ****        ****|   |  |       | || |                            ****   ****     | |                         ****| |  ****|       | |           |  | ****     | |              *****|          ||       |  |   |  |        |  ||  |                | | ..betaturn..        |  |         |  |   |  |       | |    |   ||  |||| |         |        ****| | ||| |   |       |  ||   |   ||  |****  |                              | |      | | **** |      ****|    |||  |  | ||   |               | | |    ..betaturn..         | |    | |        | |         |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |              | | |   |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||       |  |   |  |        |  ||  |                *** ..nest..        |  |         |  |   |  |       ***    |   ||  |||| |         |        |  || | *** |   |       |  ||   |   ||  |   |  |                              ***      | | |  | |       |***    ***  |  | ||   |               *** |    ..nest..         ***    | |        ***         |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****              | | |   ****       ******                            ****   ****     | |                         ||    ********                     **** ****                                      ||       ****   ****        ********                    ..niche..        ****         ****   ****              |   |*********         |        ****| |  |  |   |       ****|   |   |****   ****                                       *** ******       |        |*********|   |                 ***    ..niche..                ***                    |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    *****                                                                | |                         ||                                                                                ||                                                      ..stmotif..                                              *****                  |            | |  |  *****           *****   |   |                                                               |        |         *****                        ..stmotif..                                       |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    | |                                                                  | |                         ||                                                                                ||                                                      ..ststaple..                                                                     |            ******                          *****                                                               |        |                                      ..ststaple..                                       ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                                                                  ***                         ||                                                                                ||                                                      ..stturn..                                                                     |            ***                                                                                                 |        |                                      ..stturn..                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     **                                                                                **                                                      ..REP00000..                                                                     *                                                                                                                *        *                                      ..REP00000..                                             

chain B : ACETYLCHOLINESTERASE
member of: CATH:search3.40.50.1820GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP22303
JMol viewer RasMol script viewer  PE8 608B  ..                                                                                                                                                               *                                                                                                ..PE8 ..                                          ***  *                                                                                                                                                                                       ..PE8 ..                                                
JMol viewer RasMol script viewer  NO3 607B  ..                                                                                                                                                               |                                                                                                ..NO3 ..                                          |||  |                                                                                                                                                                                       ..NO3 ..                               *       *        
JMol viewer RasMol script viewer  NO3 606B  ..                                                                                                                                                              *|                                                                             **  *              ..NO3 ..                                          |||  |                                                                                                                                                                                       ..NO3 ..                               |       |        
JMol viewer RasMol script viewer  EDO 605B  ..                                                                                                                                                              ||                                                                             ||  |              ..EDO ..                                          |||  |                                                                        ***  **    **  *                                                                                               ..EDO ..                               |       |        
JMol viewer RasMol script viewer  NAG 604B  ..                                                                                                                                                              ||                                                                             ||  |              ..NAG ..   *  *                                   |||  |                                                                        |||  ||    ||  |                                                                                               ..NAG ..                               |       |        
JMol viewer RasMol script viewer  NAG 603B  ..                                                                                                                                                              ||                                                                             ||  |              ..NAG ..   |  |                                   |||  |                                  **                                    |||  ||    ||  |                                                                                               ..NAG ..                               |       |        
JMol viewer RasMol script viewer  NAG 602B  ..                                                                                                                                                              ||                                                                             ||  |              ..NAG ..   |  |                                   |||  |                                  || *  *                               |||  ||    ||  |                                                                                               ..NAG ..                               |       |        
JMol viewer RasMol script viewer  FUC 601B  ..                                                                                                                                                              ||                                                                             ||  |              ..FUC ..   |  |                                   |||  |                                  || |  |                               |||  ||    ||  |                                                                                               ..FUC ..                               |       |        
JMol viewer RasMol script viewer  EDO 605A  ..                                                                                                                                                              ||                                                                             ||  |              ..EDO ..   |  |                                   |||  |                                  || |  |                               |||  ||    ||  |                                                                                               ..EDO ..                               |       |        
sec str:  ...hhh.eeee..eeee.eee......eeeeeeee.....hhhhh............eee......ee..........hhhhhh......ee....eeeeeee.......eeeeeee...........hhhhhhhhhhhhhh.eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhhhhhhh...eeeee...........hhhhhhhhhhhhhhhh....... .....hhhhhhhhhh..hhhhhhhhhhhhh.....................hhhhhhhh......eeeeeee...hhhhhh..............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh........ ................eeeee.....eeee..hhhhhhhhhhhhhhhhhh
sequence :  ..EDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPP... ..TGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWANFARTGDPNEP... ..PKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSA
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254   ... ..262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482        ... ..495       505       515       525       535     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||| | | |          | |||  || ||   || || || |         |    |          | ||  |   |  |  |  |||| |     |                |||||||| || ||       | |        |  |    |  |     | |              || ||||  |      |||  |   |  |   |  |        |  || || |    || ||     |||  ..PS00001.. | ^***    |  |         |  |   |  |       ||||        |  |||| |         |        |  || |^*** |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    ||| || ||^*** ||               | | |  ..PS00001..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. ||| | | |          | |||  || ||   || || || |         |    |          | ||  |   |  |  |  |||| |     |                |||||||| || ||       | |        |  |    |  |     | |              || ||||  |      |||  |   |  |   |  |        |  || || |    |**^*     |||  ..PS00004.. | | ||    |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    ||| || ||  |  ||               | | |  ..PS00004..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||| | ^**          | |||  || ||   || || || |         |    |          | ||  |   |  |  |  |||| |     |                |||||||| || ||       | |        |  |    |  |     | |              || ||||  |      |||  |   |  |   |  |        |  || || |    |         |||  ..PS00005.. | | ||    |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |  ||  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    ||| || ||  |  ||               | | |  ..PS00005..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||| |              | |||  || ||   || || || |         |    |          | ||  |   |  |  |  |||| |     |                |||||||^*** ||       | |        |  |    |  |     | |              || ||||  |      |||  |   |  |   |  |        |  || || |    |         |||  ..PS00006.. | | ||    |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| ^***|  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    ||| || ||  ^***|               | | |  ..PS00006..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ||| |              | |||  || ||   || || || |         |    |          | ||  |   |  |  ********^     |                |||||||  || ||       | |        |  |    |  |     | |              || ||||  |      |||  |   |  |   |  |        |  || || |    |         |||  ..PS00007.. | | ||    |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |   |  |    |  ||   |   ||  || ||| |                              | |      | | |  | |    | |||||    ||| || ||  |   |               | | |  ..PS00007..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||| |              | ^*****| ^*****| || || |         ^*****          | ||  |   |  |     ||||       |                ^*****|  || ||       | |        |  |    |  |     | |              || |^*****      |||  |   |  |   |  |        |  || || ^*****         |^***..PS00008.. ^*****    |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |   |  ^*****  ||   |   ||  || ||| |                              | |      | | |  | |    ^*****|    ||| || ||  |   |               | | |  ..PS00008..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. ||| |              | |||   |  |    | || || |                         | ||  |   |  |     ||||       |                ||||| |  || ||       | |        |  |    |  |     | |              || *************^**  |   |  |   |  |        |  || ||                | |  ..PS00122..   | |     |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |   |       |  ||   |   ||  || ||| |                              | |      | | |  | |      |||||    ||| || ||  |   |               | | |  ..PS00122..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. ||| |              | |||   |  |    | || || |                         | ||  |   |  |     |**^********                ||||| |  || ||       | |        |  |    |  |     | |              || ||||  |      ||   |   |  |   |  |        |  || ||                | |  ..PS00941..   | |     |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |   |       |  ||   |   ||  || ||| |                              | |      | | |  | |      |||||    ||| || ||  |   |               | | |  ..PS00941..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ||| |              | |||   |  |    | || || |                         | ||  |   |  |     | |                         ||||| |  || ||       | |        |  |    |  |     | |              || ||||  |      ||   |   |  |   |  |        |  || ||                | |  ..asxmotif..   | |     |  |         |  |   |  |       ||||        |  |||| |         |        |  || ||||| |   |       |  ||   |   ||  |***** |                              | |      | | |  | |      |||||    ||| || ||  |   |               | | |  ..asxmotif..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  asxturn .. *** |              | |||   |  |    | || || |                         ***|  |   |  |     | |                         ||||| |  || ||       | |        |  |    |  |     | |              || ||||  |      ||   |   |  |   |  |        |  || ||                | |  ..asxturn..   ***     |  |         |  |   |  |       ||||        |  |||| |         |        |  || |***| |   |       |  ||   |   ||  |***|  |                              | |      | | |  | |      |||||    ||| |***|  |   |               | ***  ..asxturn..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |              ****|   |  |    | ****| |                            ****   ****     | |                         ****| |  ****|       | |        ****    ****     | |              *****|****      ||   |   |  |   |  |        *******|                | |  ..betaturn..           |  |         |  |   |  |       ||||        |  |||| |         |        ****| | ||| |   |       |  ||   |   ||  |****  |                              | |      | | **** |      ****|    |*****  |  |   |               | | |  ..betaturn..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |              | | |   |  |    ***| || |                            |  |   |  |     | |                         ||| | |  ||  |       | |                |  |     | |              |  | |          ||   |   |  |   |  |        |  ||  |                | |  ..gammaturn..           |  |         |  |   |  |       ||||        |  |||| |         |        |  || | ||| |   |       |  ||   |   ||  |   |  |                              | |      | | |  | |       || |    |||  |  |  |   |               | | |  ..gammaturn..            | |    | |        | |               
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |              | | |   |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***                |  |     ***              |  ***          ||   |   |  |   |  |        |  ||  |                ***  ..nest..           |  |         |  |   |  |       ****        |  |||| |         |        |  || | *** |   |       |  ||   |   ||  |   |  |                              ***      | | |  | |       |***    ***  |  |  |   |               *** |  ..nest..            ***    | |        ***               
search RasMol script viewer Motif-ligand binding stats  niche ..  ****              | | |   ****       ******                            ****   ****     | |                         ||    ********                          ****                      |    |          ||   |   ****   ****        ********                     ..niche..           ****         ****   ****                   *********         |        ****| |  |  |   |       ****|   |   |****   ****                                       *** ******       |        |*******  |   |               | ***  ..niche..                   ***                          
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                    | | |                                                                | |                         ||                                                                ******          ||   |                                                   ..schellmannloop..                                                                        |            | |  |  |   |           |   |   |   |                                                               |        |         |   |               | |    ..schellmannloop..                                                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    *****                                                                | |                         ||                                                                                ||   |                                                   ..stmotif..                                                                        |            | |  |  *****           *****   |   |                                                               |        |         *****               | |    ..stmotif..                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                    | |                                                                  | |                         ||                                                                                |*****                                                   ..ststaple..                                                                        |            ******                          *****                                                               |        |                             | |    ..ststaple..                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                    ***                                                                  ***                         ||                                                                                ||                                                       ..stturn..                                                                        |            ***                                                                                                 |        |                             ***    ..stturn..                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                     **                                                                                **                                                       ..REP00000..                                                                        *                                                                                                                *        *                                    ..REP00000..                                                

   New search    4ey4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors