triangle PDBeMotif: 4ero  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.13.11.24
Classification oxidoreductase    | release date: Fri, Apr 20, 2012
Title study on structure and function relationships in human pirin cobalt ion
Authors A.LIU, F.LIU, I.REHMANI, L.CHEN, R.FU, S.ESAKA, V.SERRANO
Method X-RAY DIFFRACTION (resolution: 2.65Å)
PDBe Citation   
Small molecules:    search CO CO binding statistics CO   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCG
HTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIK
SKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PIRIN
member of: GENE3D:searchG3DSA_2.60.120.10PANTHER:searchPTHR13903/searchPTHR13903_SF8PFAM:searchPF02678/searchPF05726PIRSF:searchPIRSF006232SUPERFAMILY:searchSSF51182UniProt:searchO00625
JMol viewer RasMol script viewer  EDO 1005A  ..                                        *                                                                         *                                                                                                                                                                             
JMol viewer RasMol script viewer  EDO 1004A  ..                                        |                                                                         |                           * *                                 **                                                                                                            
JMol viewer RasMol script viewer  EDO 1003A  ..                                        |                                                                         |                       *   | |  *                      * *     ||                                                                                                            
JMol viewer RasMol script viewer  EDO 1002A  ..            *       ***                 |  *                                                                      |                       |   | |  |                      | |     ||                                                                                                            
JMol viewer RasMol script viewer  CO 1001A  ..            |       |||                 |  |         * *                                          *               |                       |   | |  |                      | |     ||                                                                                                            
sec str:  ......eeeeee.eeeee...eeeee............eeeeeeeee.....eeeeee..eeeeeee.....eeeee....eeee....eeeee....eeeeeee.....eeeeeeeee.hhhhh....eeeeehhhhh...ee..eeeeeee.ee..ee........eeeeeeee....eeeee.....eeeeeeee..eee......eee...eeeee....eeeee......eeeeeeee.......eee..eee.hhhhhhhhhhhhhh....hhhhhh.......
sequence :  ..SSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| **^*          |  |    |  |      | |       |    |      |      |   |    | | | || | |  |     |  |    |   | |             ||| |   |   || ||      |    |    |  | | | | |         | ||   |  |  |      ||      |  |    |  |               | |           | |     | |   |  ||        | | ||||  | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**             |  |    |  |      | |       |    |      |      |   |    | | | |^** |  |     |  |    |   | |             ^** |   |   || ||      |    |    |  | | | | |         | ||   |  |  |      ||      |  |    |  |               | |           | |     | |   |  ||        | | ||||  ^**     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                |  |    |  |      | |       |    |      |      |   |    | | | |    |  |     |  |    |   | |              || |   |   || ||      |    |    |  | | | | |         | ||   |  |  |      ||      |  |    |  |               | |           | |     | |   ^***|        | | ||||  |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                |  |    |  |      | |       |    |      *******^   |    | | | |    |  |     |  |    |   | |              |******^   || ||      |    |    |  | | | | |         | ||   |  |  |      ||      |  |    |  |               | |           | |     | |   |   |        | | ||||  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                |  |    |  |      | |       ^*****                 ^***** | | |    |  |     |  ^*****   | |              |  |       || ||      ^*****    |  | | | | |         | ^*****  |  |      ||      |  |    |  |               | |           | |     | |   |   |        | | ||||  |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..                |  |    |  |      | |                                     *** |    |  |     |  |        | |              |  |       || ||                |  | | | | |         |  |      |  |      ||      |  |    |  |               | |           | |     | |   |   |        | | ||||  |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..                |  |    |  |      | |                                       | |    |  |     |  |        | |              |  |       || ||                |  | | | | |         |  |      |  |      **      |  |    |  |               | |           | |     | |   |   |        | | ||||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..                |  |    ****      | |                                       | |    ****     ****        | |              |  |       *****                **** | | | |         |  |      |  |              ****    |  |               | |           | |     | |   |   |        | ****|****       
search RasMol script viewer Motif-ligand binding stats  nest ..                |  |    |  |      | |                                       ***    |  |                 | |              |  |        |  |                     | | | |         |  |      |  |                      |  |               | |           ***     | |   |   |        *** ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                ****    ****      ***                                              ****                 ***              ****        ****                     *** ***         ****      ****                      ****               ***                   ***   |   |                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                              | |                                                                                                *****                          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                              ***                                                                                                                               

   New search    4ero:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors