triangle PDBeMotif: 4e9f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.
Classification hydrolase/dna    | release date: Wed, Mar 21, 2012
Title stucture of the glycosylase domain of mbd4 bound to ap site dna
Authors A.VIGOUROUX, S.MORERA
Method X-RAY DIFFRACTION (resolution: 1.79Å)
PDBe Citation   
Small molecules:    search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MLSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKP
LGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLSHHHHH
H
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : METHYL-CPG-BINDING DOMAIN PROTEIN 4
member of: CATH:search1.10.340.30GENE3D:searchG3DSA_1.10.340.30PANTHER:searchPTHR15074/searchPTHR15074_SF2PFAM:searchPF00730PIRSF:searchPIRSF038005SUPERFAMILY:searchSSF48150UniProt:searchO95243
JMol viewer RasMol script viewer  EDO 101C  ..                               *                                                                                                          
sec str:  .............hhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...hhhhhhhhhhhh..hhhhh...hhhhhhhhhhhhhh.
sequence :  ..KWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENH
seq num:  ..437       447       457       467       477       487       497       507       517       527       537       547       557       567     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||   | | |    |  | |     || |^*** |              |   |  || |          | |          | | ||    |  |  |    ^***||  |  |  | | |   |          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*^*   | | |    |  | |     || || || |              |   |  || |          | |          | | ||    |  |  |      | ||  |  |  | | |   |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | | |    |  | |     || || |^**              |   |  || |          | |          | | ||    |  |  |      ^**|  |  |  | | |   |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | | |    |  | |     || || |                 |   |  || |          | |          | | ||    |  |  |         |  |  |  | | *****          
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | | |    |  ***     || || |                 |   |  |***          | |          | | ||    |  |  |         |  |  |  | | |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | | |    |  |       |**** |                 |   ****             | |          | | ||    ****  |         |  |  |  | | |              
search RasMol script viewer Motif-ligand binding stats  nest ..      | ***    |  |       || || |                 |   |  |             ***          | | ||    |  |  |         |  |  |  | | |              
search RasMol script viewer Motif-ligand binding stats  niche ..      | |      ****       |******                 |   ****                          | ****    *******         ****  **** ***              
search RasMol script viewer Motif-ligand binding stats  stmotif ..      | |                 |                       *****                             |   |                                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..      | |                 |                                                         *****                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..      ***                 |                                                                                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                          *                                                                                                               

chain C : DNA (5'-D(*CP*CP*AP*GP*CP*GP*(3DR)P*GP*CP*AP*GP*C
JMol viewer RasMol script viewer  EDO 101C  ..    **      
sec str:  ..............
sequence :  ..CCAGCGNGCAGC
seq num:  ..1           

chain D : DNA (5'-D(*GP*CP*TP*GP*CP*GP*CP*GP*CP*TP*GP*G)-3'
JMol viewer RasMol script viewer  EDO 101C  ..            
sec str:  ..............
sequence :  ..GCTGCGCGCTGG
seq num:  ..1           

   New search    4e9f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors