triangle PDBeMotif: 4dj9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification cell adhesion    | release date: Wed, Feb 1, 2012
Title human vinculin head domain vh1 (residues 1-258) in complex w talin vinculin binding site 50 (vbs50, residues 2078-2099)
Authors C.VONRHEIN, E.S.RANGARAJAN, G.BRICOGNE, S.D.YOGESHA, T.IZARD
Method X-RAY DIFFRACTION (resolution: 2.25Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTY
TKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAW
Chain B sequence:
ETQVVLINAVKDVAKALGDLISATKAAAG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VINCULIN
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... ...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..VFHTRTIESILEPVAQQISHLVIMHEEG..KAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTT... ..QGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
seq num:  ..3         13        23      ..35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205        ... ..221       231       241       251 
search RasMol script viewer Motif-ligand binding stats  PS00001 ..   |   ||  |                ..                         | | || | |                       | | ||  |      |   | ||   |     |  |                 | || | | ||| | ||                |  ||| |      |   | ||             | ..PS00001.. |    | | ^***   |        |  ||  |
search RasMol script viewer Motif-ligand binding stats  PS00005 ..   |   ||  |                ..                         | | || | |                       | | ||  |      |   | ||   |     |  |                 | || | | ||| | ||                |  ||| |      |   ^**|             ^*..PS00005.. |    | |   ||   |        |  ||  |
search RasMol script viewer Motif-ligand binding stats  PS00006 ..   |   |^***                ..                         | | ^*** |                       | | ||  |      |   | ||   |     ^***                 ^*** | ^***| | ||                |  |^***      |   ^***               ..PS00006.. |    | |   ||   |        |  |^***
search RasMol script viewer Motif-ligand binding stats  PS00008 ..   |   |                    ..                         | | || | |                       | | ||  |      |   | ^*****                            |  | | | | | ||                |  | |        |   |                  ..PS00008.. ^***** |   ||   |        |  |    
search RasMol script viewer Motif-ligand binding stats  PS00663 ..   |   |                    ..                         | | || | |                       | | ||  |      |   |  |   |                            |  | | | | | |********************* |        |   |                  ..PS00663..        |   ||   |        |  |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |   |                    ..                         | | || ***                       | | ||  |      |   |  |   |                            |  | | | | | |                 |  | |        |   |                  ..asxturn..        |   ||   |        |  |    
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |                    ..                         | ******                         | *******      |   |  |   |                            **** | | | | |                 ******        |   |                  ..niche..        |   ||   |        ****    
search RasMol script viewer Motif-ligand binding stats  stmotif ..   *****                    ..                         |   || |                         |   |          |   |  |   |                                 ***** | |                               |   |                  ..stmotif..        |   ||   |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                            ..                         *****| |                         *****          *****  *****                                   *******                               *****                  ..ststaple..        **********                
search RasMol script viewer Motif-ligand binding stats  stturn ..                            ..                              ***                                                                                                                                                    ..stturn..                                  

chain B : TALIN-1
sec str:  ...hhhhhhhhhhhhhhhhhhhhh
sequence :  ..VVLINAVKDVAKALGDLISATK
seq num:  ..2078      2088        

   New search    4dj9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors