triangle PDBeMotif: 4day  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.6.4.13
Classification protein binding/hydrolase    | release date: Fri, Jan 13, 2012
Title crystal structure of the rmi core complex with mm2 peptide f
Authors J.L.KECK, K.A.HOADLEY
Method X-RAY DIFFRACTION (resolution: 3.30Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMSSENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDE
ILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Chain B sequence:
GSHMAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDP
SGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Chain C sequence:
GHMEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RECQ-MEDIATED GENOME INSTABILITY PROTEIN 1
member of: PANTHER:searchPTHR14790/searchPTHR14790_SF15UniProt:searchQ9H9A7
sec str:  .............hhhhhhhhh....eeeeeeeeeeee.....hhhhh....eeee....eeeeeehhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeeee......eeeeeee..hhhhhhhhhhhh..
sequence :  ..IAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
seq num:  ..482       492       502       512       522       532       542       552       562       572       582       592       602       612       622 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..*  |  |         |  |     | |         |^***||    || |  |||||             | ||  |   | ||   |  || |    |  |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |         |  |     ^**         |  | ||    |^**  |||||             | ||  |   ^**|   |  || |    |  |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |         |  |                 |  | ||    |  |  |||||             | |^***   ^***   |  || |    |  |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |  |         |  |                 |  | ||    |  *******^             | |          |   |  || |    |  |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |         |  |                 ^*****^*****     ||||              | |          |   |  || ^*****  |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |         |  |                    | |           ||||              | |          |   *****         |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |         |  |                    | |           ||||              | |          *****  |          |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |         |  |                    | |           ***|              | |              |  |          |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |  |         ****                    | |           ||||              | |              ****          |  |           | |                    | |
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                                 | |           ****              ***                            |  |           ***                    ***
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                                 ***                                                            ****                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        ***                                                                                                     

chain B : RECQ-MEDIATED GENOME INSTABILITY PROTEIN 2
member of: CATH:search2.40.50.140UniProt:searchQ96E14
sec str:  ............ee.hhhhhhhh...eeeeeeeeeeee..eeeee....eeeeehhhhh...........eeeeeeee.......eeeeeeeee....hhhhhhhhhhhhhhhhh..
sequence :  ..AGVRLPRSPPLKVLAEQLRRD..AAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
seq num:  ..13        23         ..56        66        76        86        96        106       116       126       136         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |                  ..         || |  |          ^**||| |       |  |     |    |        ||   |  ||   |  |      |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |                  ..         || |  |             ||| |       |  |     |    |        ||   |  ||   ^***      |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..***                  ..         || |  |             ||| |       |  |     ^*****        ||   |  ||   |         |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..                     ..         ** |  |             ||| |       |  |                   **   |  ||   |         |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                     ..            ****             ||| |       |  |                        |  ||   |         |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..                     ..                             *** |       |  |                        |  ||   |         |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                     ..                              ****       ****                        ****|   |         **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     ..                                                                         *****              

chain C : FANCONI ANEMIA GROUP M PROTEIN
member of: PANTHER:searchPTHR14025/searchPTHR14025_SF20UniProt:searchQ8IYD8
sec str:  ..............
sequence :  ..DLFSVTFDLGFC
seq num:  ..1226        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            

   New search    4day:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors