triangle PDBeMotif: 4cy1  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Wed, Apr 9, 2014
Title crystal structure of the kansl1-wdr5 complex.
Authors J.BRETTSCHNEIDER, J.DIAS, J.KADLEC, S.CUSACK
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN
LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY
CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDCGA
Chains C,D sequence:
DGTCVAARTRPVLSY
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : WD REPEAT-CONTAINING PROTEIN 5
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR22847/searchPTHR22847_SF308PFAM:searchPF00400PIRSF:searchPIRSF002394PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchP61964
JMol viewer RasMol script viewer  GOL 1335A  ..                                                                                                           * * *                                        *                             ..GOL ..                                                                                                                         
sec str:  .......eeeeee......eeeeee.....eeeeee...eeeeee.....eeeeee.....eeeeee.....eeeeee....eeeee....eeeeee......eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee...... .....eeeeee......eeeee...eeeeee....eeeeee...........eeee.....eeee......eeeee.....eeeee......eeeeee.....eeeeee......eeeee...
sequence :  ..VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDD... ..NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
seq num:  ..31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201         ... ..214       224       234       244       254       264       274       284       294       304       314       324        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ||          | | | ||||   || | |    |  | | ||                ||||| | ||| | |  || | | ||| |             |||||   | ||| |   | | | ||                |||||  || | |     | | | |||  | ..PS00001..         | ||||      | | |  | || |    |  |         ^***     | || || |     | | | ||         ||   |  |       |  ||| |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ||          ^** | ||||   || | |    |  | | ||                ||||| | ||| ^**  || ^** ||^**             |||||   | ||^**   | ^** ||                |||||  || | |     | | | |||  | ..PS00005..         | ||||      | ^**  | || |    |  |                  | || || |     | | | ||         ||   |  |       |  ||^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ||              | ||||   ^*** |    |  | | ||                ||||| ^***| |    || | | ||                |||||   ^***|     | | | ||                |||||  ^*** |     | | | ||^*** ..PS00006..         | ||||      | |    | || |    |  |                  | ^***| |     | | | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ||              | ||||    | | |    ^***** ||                |||||   | | |    || | | ||                |||||   | | |     | | | ||                |||||   | | |     | | | ||     ..PS00008..         | ||||      | |    | || |    |  |                  |  ^*****     | | | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..       ||              | ||||    | | |       | | ||                ||||*************** | | ||                ||||*************** | | ||                ||||*************** | | ||     ..PS00678..         | ||||      | |    | || |    |  |                  *************** | | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ||              | ||||    | | |       | | ||                ||||    | | |    |  | | ||                ||||    | | |       | | ||                ||||    | | |       | | ||     ..alphabetamotif..         | ||||      | |    | || |    |  |                        | |       | | ||         ||   |  |       *****|        
search RasMol script viewer Motif-ligand binding stats  asxturn ..       ||              | ||||    | ***       | | ||                ||||    | ***    |  | | ||                ||||    | ***       | | ||                ||||    | ***       | | ||     ..asxturn..         | ||||      | |    ***| |    |  |                        | |       | | ||         ||   |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..       **              | ||||    | | |       | | **                ||||    | | |    |  | | **                ||||    | | |       | | **                ||||    | | |       | | **     ..betabulge..         | ||||      | |       | |    |  |                        | |       | | **         **   |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                       | ||||    | | |       | |                   ||||    | | |    ******                   ||||    | | |       | |                   ||||    | | |       | |        ..betabulgeloop..         | ||||      | |       | |    |  |                        | |       | |                 |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       ****||    | | |       | |                   ||||    | | |       | |                   ||||    | | |       | |                   ||||    | | |       | |        ..betaturn..         ****||      | |       | |    |  |                        | |       | |                 |  |       **** |        
search RasMol script viewer Motif-ligand binding stats  nest ..                         ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***        ..nest..           ****      ***       ***    |  |                        ***       ***                 |  |          ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                 | |                                ***    | |                                       | |         | |                           | |         | |        ..niche..                                      ****                                  | |                 ****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 ***                                       ***                                       ***         ***                           ***         ***        ..stturn..                                                                            ***                                          

chain D : KAT8 REGULATORY NSL COMPLEX SUBUNIT 1
member of: PANTHER:searchPTHR22443/searchPTHR22443_SF14UniProt:searchQ7Z3B3
sec str:  ......hhhhh.....
sequence :  ..GTCVAARTRPVLSY
seq num:  ..586       596 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  |     
search RasMol script viewer Motif-ligand binding stats  niche ..     ****     

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : WD REPEAT-CONTAINING PROTEIN 5
member of: GENE3D:searchG3DSA_2.130.10.10PANTHER:searchPTHR22847/searchPTHR22847_SF308PFAM:searchPF00400PIRSF:searchPIRSF002394PRINTS:searchGPROTEINBRPTPROSITE PATTERNS:searchPS00678, PROSITE PROFILES:searchPS50082/searchPS50294, SMART:searchSM00320SUPERFAMILY:searchSSF50978UniProt:searchP61964
JMol viewer RasMol script viewer  GOL 1335B  ..                                                                                                          * *                                          *                *           ..GOL ..                                                                                                                         
sec str:  ......eeeeee......eeeeee.....eeeeee...eeeeee.....eeeeee.....eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee......eeeeee.....eeeeee....eeeee.....eeeee..... .....eeeeee.....eeeeee...eeeeee....eeeeee...........eeee.....eeee......eeeee.....eeeee......eeeeee.....eeeeee......eeeee...
sequence :  ..KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLID... ..NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
seq num:  ..32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       ... ..214       224       234       244       254       264       274       284       294       304       314       324        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      ||          | | | ||||   || | |    |  | | ||              | ||||| | ||| | |   | | |   | |      ||   | |||||   | ||| |  |||| | ||                |||||  || | |     | | | |||  |..PS00001..         | ||||      | | |  | || |    |  |         ^***     | || || |    |||| | ||         ||   |  |       |  ||| |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ||          ^** | ||||   || | |    |  | | ||              | ||||| | ||| ^**   | ^**   ^**      ||   | |||||   | ||^**  |||^** ||                |||||  || | |     | | | |||  |..PS00005..         | ||||      | ^**  | || |    |  |                  | || || |    |||| | ||         ||   |  |       |  ||^**      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ||              | ||||   ^*** |    |  | | ||              | ||||| ^***| |     | | |            ||   | |||||   ^***|    |||| | ||                |||||  ^*** |     | | | ||^***..PS00006..         | ||||      | |    | || |    |  |                  | ^***| |    |||| | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ||              | ||||    | | |    ^***** ||              | |||||   | | |     | | |            ||   | |||||   | | |    |||| | ||                |||||   | | |     | | | ||    ..PS00008..         | ||||      | |    | || |    |  |                  |  ^*****    |||| | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  WD_REPEATS_1 ..      ||              | ||||    | | |       | | ||              | ||||*************** | |            ||   | ||||***************|| | ||                ||||*************** | | ||    ..PS00678..         | ||||      | |    | || |    |  |                  ***************|| | ||         ||   |  |       |  |||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||              | ||||    | | |       | | ||              | ||||    | | |       | |            ||   | ||||    | | |    | || | ||                ||||    | | |       | | ||    ..alphabetamotif..         | ||||      | |    | || |    |  |                        | |    | || | ||         ||   |  |       *****|        
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ||              | ***|    | ***       | | ||              | ||||    | ***       | |            ||   | ||||    | ***    ***| | ||                ||||    | ***       | | ||    ..asxturn..         | ||||      | |    ***| |    |  |                        | |    ***| | ||         ||   |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..      **              | ||||    | | |       | | **              | ||||    | | |       | |            **   | ||||    | | |       | | **                ||||    | | |       | | **    ..betabulge..         | ||||      | |    |  | |    |  |                        | |       | | **         **   |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                      | ||||    | | |       | |                 | ||||    | | |       | |                 | ||||    | | |       | |                   ||||    | | |       | |       ..betabulgeloop..         | ||||      | |    ******    |  |                        | |       | |                 |  |       |  | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                      ****||    | | |       | |                 ****||    | | |       | |                 ****||    | | |       | |                   ||||    | | |       | |       ..betaturn..         ****||      | |       | |    |  |                        | |       | |                 |  |       **** |        
search RasMol script viewer Motif-ligand binding stats  nest ..                        ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***                   ****    | ***       ***       ..nest..           ****      ***       ***    |  |                        ***       ***                 |  |          ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                                | |                                       | |         | |                           | |         | |                           | |         | |       ..niche..                                      ****                                  | |                 ****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                ***                                       ***         ***                           ***         ***                           ***         ***       ..stturn..                                                                            ***                                          

chain C : KAT8 REGULATORY NSL COMPLEX SUBUNIT 1
member of: PANTHER:searchPTHR22443/searchPTHR22443_SF14UniProt:searchQ7Z3B3
sec str:  ......hhhhh.....
sequence :  ..GTCVAARTRPVLSY
seq num:  ..586       596 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****  |     
search RasMol script viewer Motif-ligand binding stats  niche ..     ****     

   New search    4cy1:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors