triangle PDBeMotif: 4c6c  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.2.3
Classification hydrolase    | release date: Wed, Sep 18, 2013
Title crystal structure of the dihydroorotase domain of human cad in apo-form obtained recombinantly from hek293 cells.
Authors A.GRANDE-GARCIA, N.LALLOUS, S.RAMON-MAIQUES
Method X-RAY DIFFRACTION (resolution: 1.45Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search FMT FMT binding statistics FMT
Modified residues:  search KCX KCX binding statistics KCX
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPMTSQKLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFAL
FLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHIC
HVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLE
EKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTP
FEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPPSAPATSEMTTTPERPRRGIPGLPD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CAD PROTEIN
member of: GENE3D:searchG3DSA_3.20.20.140PANTHER:searchPTHR11405/searchPTHR11405_SF5PFAM:searchPF13147PROSITE PATTERNS:searchPS00482/searchPS00483, SUPERFAMILY:searchSSF51338/searchSSF51556/searchSSF52335UniProt:searchP27708
JMol viewer RasMol script viewer  FMT 2829A  ..             * *                             *                                                                                                                                                                                      * *           *                                                                                                                       
JMol viewer RasMol script viewer  FMT 2828A  ..             | |                             |                                                                                                                                                                                      | |           |                                                                                                                       
JMol viewer RasMol script viewer  FMT 2827A  ..             | |                             |                                                                                                                                                                                      | |           |                               *  *                                                                                    
JMol viewer RasMol script viewer  FMT 2826A  ..             | |                             |                                                                                **                    ****                                                                            | |           |                               |  |                                                                                    
JMol viewer RasMol script viewer  ZN 2825A  ..             | |                             |                                                                                ||                    ||||                                                                            | |           |                               *  |                                                                                    
JMol viewer RasMol script viewer  ZN 2824A  ..           * | |                             |                                                                                ||                    |||| *                       *                                                  | |           |                               |  |                                                                                    
JMol viewer RasMol script viewer  ZN 2823A  ..           | | |                             |                                                  *                             ||  *                 |||| |*                      |                                                  | |           |                               |  |                                                                                    
JMol viewer RasMol script viewer  ZN 2822A  ..           * * |                             |                                                  *                             ||  |                 |||| ||                      |                                                * | |           |                               |  |                                                                                    
sec str:  ....eeee.eeeeee...........hhhhhhhhhhhh.eeeeee.........hhhhhhhhhhhhhhhh..eeee.ee...........hhhhh..eeee...........hhhhhhhhhhhh.....eeee..hhhhhhhhhhhhhh...eee....hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhh.ee.......hhhhhh.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.......eeeeeeeeeee..................eeeeeeeeeee..eeeee..ee.........hhhhhhhh.....
sequence :  ..KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLP
seq num:  ..1460      1470      1480      1490      1500      1510      1520      1530      1540      1550      1560      1570      1580      1590      1600      1610      1620      1630      1640      1650      1660      1670      1680      1690      1700      1710      1720      1730      1740      1750      1760      1770      1780      1790      1800      1810        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|        | | || ||| | |||| ||| ||| | |           | ||   |   || || ||          | ||||||  ||| |  |    ^***|| |  | |   |||||||  |      |  |      |   | |            |  | | |||||   |     |  || ||| ||  |  |      |  |   |  ||  |   || |   |  ||                |  |||| |||||  |            | |     |  | |  |       |  | | || || |    | ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*        | | || ||| ^**||| ||| ||| | |           | ||   |   || || ||          | ||||||  ||| |  |      | || |  | |   |||||||  |      |  |      |   ^**            |  | | |||||   |     |  || ||| ||  |  |      |  |   |  ||  |   || |   |  ||                |  |||| |||||  |            | |     |  | |  |       |  | | || || |    ^**|       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | | || ||| ^***|| ||| ||| | |           | ||   |   || || ||          | ||||||  ||| |  |      ^*** |  | |   |||||||  |      |  |      |   | |            |  | | |||||   |     |  |^***| ||  |  |      ^***   |  ||  |   || |   ^***|                |  |||| ||||^***            | |     ^*** |  |       |  | | |^*** |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | | || ||| |   || |^***** | |           | ||   |   || || ||          | |||^*****|^*****        |  |  | |   |||||||  |      |  |      |   | |            |  | | |||^*****     |  || ||| ||  |  |             |  ||  |   || |       |                |  |||| ||||                | |          |  |       |  | | || || |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  DIHYDROOROTASE_1 ..         **^*^****| |   || ||| ||| | |           | ||   |   || || ||          | ||||||   |  |           |  |  | |   |||||||  |      |  |      |   | |            |  | | |||||         |  || ||| ||  |  |             |  ||  |   || |       |                |  |||| ||||                | |          |  |       |  | | || || |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  DIHYDROOROTASE_2 ..              | | | |   || ||| ||| | |           | ||   |   || || ||          | ||||||   |  |           |  |  | |   |||||||  |      |  |      |   | |            |  | | |||||         |  || ||| ||  |  |             |  ||  |   ************                |  |||| ||||                | |          |  |       |  | | || || |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              | | | |   || |****** | |           | ||   |   ********          | ||||||   |  |           |  |  | |   |*****|  |      |  |      |   | |            |  | | |||||         |  || |*****  |  |             |  ||  |    | |                        |  |||| ||||                | |          |  |       |  | | || || |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..              | | | |   || ||| ||  | |           | |*****   || || ||          | ||||||   |  |           |  |  | |   |||||||  |      |  |      |   | |            |  | | |||||         |  || ||| ||  |  |             |  ||  |    | |                        |  |||| ||||                | |          |  |       |  | | || || |      ||       ||       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  betabulge ..              | | | |   || ||| ||  | |           | |        || || ||          | ||||||   |  |           |  |  | |   |||||||  |      |  |      |   | |            |  | | |||||         |  || ||| ||  |  |             |  ||  |    | |                        |  |||| ||||                | |          |  |       |  | | || || |      **       **       | |||  |  || ||     
search RasMol script viewer Motif-ligand binding stats  betaturn ..              | | | |   *********  | |           | |        *******|          | |****|   |  |           |  |  | |   *****||  |      ****      |   | |            **** ******|         |  || |*****  |  |             ****|  |    | |                        ****|*****||                | |          |  |       |  | | || ****                        ****|  |  ****|     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..              | | | |    |   |     | |           ***            |  |          | | || |   |  |           |  |  | |   | | |||  |                |   | |                     | |         |  || |       |  |                 |  |    | |                        |   |   ||||                | |          |  |       |  | | || || |                          | |  |  ||  |     
search RasMol script viewer Motif-ligand binding stats  nest ..              *** ***    |   |     ***                          |  |          | | |***   |  |           |  |  | |   | | |||  |                |   ***                     ***         |  || |       |  |                 |  |    ***                        |   |   ****                ***          |  |       |  | ***| || |                          ***  |  ||  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                         |   |                                  ****          | ***      ****           ****  | |   | ********                |   |                                   ****| |       ****                 ****                               |   |                                    ****       ****    ******                          ***  ********     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         *****                                                | |                             | |   *****                     *****                                       | |                                                               *****                                                                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                              ***                             ***                                                                         ***                                                                                                                                                                             

   New search    4c6c:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors