triangle PDBeMotif: 4bzn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.1
Classification transferase    | release date: Mon, Jul 29, 2013
Title crystal structure of pim1 in complex with a pyrrolo(1,2-a) pyrazinone inhibitor
Authors A.GALVANI, A.MARSIGLIO, B.SA, C.ORRENIUS, C.PIUTTI, D, D.FAIARDI, D.G.MIRIZZI, E.ARDINI, E.CASALE, E.R.FELDER, F.CASUSCELLI, G.CERVI, G.FOGLIATTO, G.PAPEO, M.D'ANELLO, M.MONTEMARTINI, N.AVANZI, R.D.FERGUSON
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search UGX UGX binding statistics UGX
Modified residues:  search SEP SEP binding statistics SEP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGE
LPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCH
NCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGD
IPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE PIM-1
member of: GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR22984/searchPTHR22984_SF4PFAM:searchPF00069PIRSF:searchPIRSF037993PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP11309
JMol viewer RasMol script viewer  UGX 1306A  ..           **   *  *            * *                                    *               ***     *                                             *          **                                                                                                                       
sec str:  ..hhhhheeeeeeeeee..eeeeeeee.....eeeeeeee.hhh..eee.....eeehhhhhhhhh.........eeeeee...eeeeeee....eeehhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeee....eeee......ee...........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.....hhhhhhhh........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhh...hhhhhhhhhh.
sequence :  ..PLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLH
seq num:  ..33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |     || |  | |  |    | |    |   |  |     | ^***        | ||| |  |        |  |              |   | |                      | ||| | | || || ||  | |    | |     | |  |  | ||  |  |   | |                   | |  | |     | |                |  | ||||| |  ||  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |  |     || |  | |  |    | |    |   |  |     | |||         **^*| |  |        |  |              |   | |                      | ||| | | || || ||  | |    | |     | |  |  | ||  |  |   | |                   | |  | |     | |                |  | ||||| |  ||  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |     || |  | |  |    | |    |   |  |     | |||         |  || |  |        |  |              |   ^**                      | ||| | | || || ||  | |    | |     | |  |  | ||  |  |   | |                   | |  | |     | |                |  | ||^** |  ||  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |     || |  | |  |    | |    |   |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || || ||  | |    | |     | |  ^*** ||  ^***   | |                   | |  | |     | |                |  | || || ^***|  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..*****^     || |  | |  |    | |    |   |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || || ||  | |    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |     || ^*****  ^***** |    |   |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || || ||  | |    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..  |  |     ************************   |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || || ||  | |    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..  |  |     || |  |         | |        |  |     | |||         |  || |  |        |  |              |   |                        | ||****^********|  | |    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |     || |  |         | |        |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || ||  |  | |    ***     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..  |  |     ** |  |         | |        |  |     | |||         |  || |  |        |  |              |   |                        | ||| | | || ||  |  | |    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |        |  |         | |        |  |     *****         |  || |  |        |  |              |   |                        | ||| | | || ||  ******    | |     | |       ||  |      | |                   | |  | |     | |                |  | || ||     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |        ****         | |        |  |     ****|         |  || |  |        |  |              |   |                        ****| | | ****|     | |    | |     | |       |****      | |                   | |  | |     | |                |  | ****|     *******| | |   |      
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                     ***        |  |       ***         |  || |  |        |  |              |   |                          *** *** || ||     ***    ***     | |       ||  |      ***                   ***  | |     ***                |  | ||  |     |  || || | |   |      
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                ****                   **********        ****              |   |                                | |****                    ***       |****                                 ***                        **********     ********** |   |      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                 | |                             *****                                | |  |                               |                                                                                          *****      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                 ***                                                                  | |  |                               |                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                      * *  *                               *                                                                                                     

   New search    4bzn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors