triangle PDBeMotif: 4bpu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.7.
Classification transferase    | release date: Tue, May 28, 2013
Title crystal structure of human primase in heterodimeric form, comprising pris and truncated pril lacking the c-terminal fe-s domain.
Authors L.PELLEGRINI, M.L.KILKENNY, R.L.PERERA
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,C sequence:
GTSMETFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYK
IDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLW
VYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENK
ESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLL
KSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEH
FLENLDKSRKGELLKKSDLQKDF
Chains B,D sequence:
MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRK
LKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKT
LREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAV
QSDERLQPLLNHL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DNA PRIMASE SMALL SUBUNIT
member of: GENE3D:searchG3DSA_3.90.920.10PANTHER:searchPTHR10536PFAM:searchPF01896SUPERFAMILY:searchSSF56747TIGRFAMS:searchTIGR00335UniProt:searchP49642
JMol viewer RasMol script viewer  GOL 1413A  ..                                                                                                                           *                               *                                                                                                                           ..GOL ..                                       *              **               ..                              
JMol viewer RasMol script viewer  GOL 1412A  ..                                                                                                                           |                         ***   |                                                                                                                           ..GOL ..                                       |              ||               ..                   *  *       
JMol viewer RasMol script viewer  GOL 1411A  ..                                                                                                                           |                         |||   |                                                                                                             *   *         ..GOL ..   *   *                               |              ||               ..                   |  |       
JMol viewer RasMol script viewer  GOL 1410A  ..                                                                                                                 **        |                         |||   |                                                                                  *                          |   |         ..GOL ..   |   |  *                            |              ||               ..                   |  |       
JMol viewer RasMol script viewer  ZN 1409A  ..                                                                                                                 ||  **    |*  *                     |||   |                                                                                  |                          |   |         ..ZN ..   |   |  |                            |              ||               ..                   |  |       
sec str:  ......hhhhhhhhhhhhh.hhhhhhhhhhhhhh.......eeeeeeehhheeeeee...hhhhhhhhhhhhh..eeeeeeee..hhhhhhhh......eee..eeeeee.hhhh...........hhhhhhhhhhhhhhhhhhhhhh.....eeeee....eeeeee.hhhhhh.hhhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh... ...hhhhhhhhhhhh...hhhhhhh....ee................hhhhhhhh......hhhhhhhhhh.......hhhhh.hhhhhhhhhhhhhhhhhhhhh
sequence :  ..FDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNN... ..PWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAI..RTRDYKKTSLAPYVKVFEHFLENLDKSRKG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274      ... ..290       300       310       320       330       340       350        ..379       389       399       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |       |  ||  |  || |||| || | |||| |    |||||         ^*** |||| ||  ||   |   |||  || ||| |||  ||        || ||  |  ||| |        |  ||  | ||||  | |       | ||     | | ||| || || ||| |||||||  | | |    | |    |  ||      |  |    |||| ||  | | || | || ||| | ||| |   ||||||||| ||  |  ..PS00001..    | |||||||     ^***|  |   |  |    | |        || || |  | |   |       ..    || ||| ||||||||  |    | | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |       |  ||  |  || |||| || | |||| |    |||||           || |||| ||  ||   |   |||  || ||| |||  ||        || ||  |  ||| |        |  ||  | ||||  | |       | ||     | | ||**^* || ||| |||||||  | | |    | |    |  ||      |  |    |||| ||  | | || | || ||| | ||| |   ||||||||| ||  |  ..PS00004..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |**^*| ||||||||  |    | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |       |  ||  |  || |||| || | |||| |    ^**||           || |||| ||  ||   |   ^**  || ^** |||  ||        || ||  |  ||| |        |  ||  | ||||  | |       ^**|     | | ^** |  || ||| |||||||  | | |    ^**    |  ||      |  |    |||| ||  | | || | || ||| | ||| |   ||||||||| ||  |  ..PS00005..    | |||||||      |  |  |   |  |    ^**        || || |  | |   |       ..    |  | | ||||||||  |    ^** 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |       |  ||  |  || |||| || | |||| |    ^***|           ^***||| ||  ||   |    |   || ||| |||  ||        |^***  |  |^***        |  ||  | ||||  | |       | ||     | |  |  |  || ||| |||||||  | | |    | |    |  ||      |  |    |||| ||  | | || | |^***| | ||| |   ||||||||| ||  |  ..PS00006..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | ||||||||  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |       |  ||  |  || |||| |^*****|| |     |  |            |  ||| ||  ||   ^*****   || ||| ^*****|        |  ||  |  | | |        |  ||  | ||||  | |       | ||     | |  |  |  || ||| |||||||  | | |    | |    |  ||      |  |    |||| ||  | | || | |  | | | ||| |   ||||||||| ||  |  ..PS00008..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | ||||||||  |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |       |  ||  |  || |||| || | | || |     |  |            |  ||| ||  ||            || ||| |||  ||        |  ||  |  | | |        |  ||  | ||||  | |       ^***     | |  |  |  || ||| |||||||  | | |    | |    |  ||      |  |    |||| ||  | | || | |  | | | ||| |   ||||||||| ||  |  ..PS00009..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | ||||||||  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |       *****  *********| || | | || |     |  |            *****| ||  ||            || ||| |||  ||        |  ||  |  | | |        *****  *****|  | |       | |      | |  |  |  **********||||  | | |    | |    *****      |  |    |||| ||  | | || | |  | | ***** |   |******|| ||  |  ..alphabetamotif..    | *******      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | *******|  |        
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |       |  |   |  || || | || | | || |     |  |            |  ||| ||  ||            || ||| |||  ||        |  ||  |  | | |        |  |   | || |  | |       | |      | |  |  |  || ||| || ||||  | | |    | |    |  |       |  |    |||| ***** | || | |  | | | ||  |   |||||| || ||  |  ..asxmotif..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | |||||| |  |        
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***       |  |   |  || || | || | | || |     |  |            |  ||| ||  ||            || ||| |||  ||        |  ||  |  | | |        |  |   | || |  | |       | |      | |  |  |  || ||| || ||||  | | |    | |    |  |       |  |    ||||  |  | | || | |  | | | ||  |   |||||| || ||  |  ..asxturn..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | |||||| |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..           |  |   |  || || | || | | || |     |  |            |  ||| ||  **            || ||| |||  **        |  ||  |  | | |        |  |   | || |  | |       | |      | |  |  |  || ||| || ||||  | | |    | |    |  |       |  |    ||||  |  | | || | |  | | | ||  |   |||||| || ||  |  ..betabulge..    | |||||||      |  |  |   |  |    | |        || || |  | |   |       ..    |  | | |||||| |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****   ******** | || | **** |     ****            *********                ****|****|            ****|  |  | | |        ****   ******  | |       | |      | |  |  |  ********* ||||  | | |    | |    ****       ****    ||||  **** **** | **** | *******   ****** ********  ..betaturn..    ********|      |  |  |   ****    | |        ****| |  | |   |       ..    |  | | ****** ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | || | | |  |                                               |  |  | |                |  |  | | |                       | |       | |      | |  |  |         |  |***  | | |    | |                       ||||         |  |      |   ||  |                    ..gammaturn..         |  |      |  |  |   |  |    | |         |  | |  | |   |       ..    |  | |                    
search RasMol script viewer Motif-ligand binding stats  nest ..                           ****** ***  |                                               |  |  ***                |  |  | | |                       ***       ***      | |  |  |         |  | |   | | |    | |                       ****         |  |      |   ||  |                    ..nest..         |  |      |  |  |   |  |    ***         |  | |  | |   |       ..    |  | |                    
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ****                                               ****  ***                ******* ***                                          ***  ****         ******   *****    ***                                    ****      |   |****                    ..niche..         ****      *******   ****    | |         **** **** |   |       ..    **** |                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                                                                                                                                          |   |                        ..stmotif..                                     | |                   *****       ..       | |                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                          *****                        ..ststaple..                                     | |                               ..       | |                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                       ..stturn..                                     ***                               ..       ***                    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : DNA PRIMASE SMALL SUBUNIT
member of: GENE3D:searchG3DSA_3.90.920.10PANTHER:searchPTHR10536PFAM:searchPF01896SUPERFAMILY:searchSSF56747TIGRFAMS:searchTIGR00335UniProt:searchP49642
JMol viewer RasMol script viewer  ZN 1409C  ..                                                                                                                     **     *  *                                                                                                                                                    ..ZN ..                                                                    ..                       
sec str:  ......hhhhhhhhhhhhh.hhhhhhhhhhhhhh.......eeeeeeehhheeeeee...hhhhhhhhhhhhh..eeeeeeee..hhhhhhhh......eee..eeeeee.hhhh...............hhhhhhhhhhhhhhhhhh.....eeeee....eeeeee.hhhhhh.hhhhhhhhhhhhh..................hhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh... ...hhhhhhhhhhhh...hhhhhhh....ee................hhhhhhhh......hhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh
sequence :  ..FDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAANPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRY... ..PWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICREL..TSLAPYVKVFEHFLENLDKSRKG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274   ... ..290       300       310       320       330       340       350     ..386       396          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         |  |     | |||||||| || | |||| |    |||||         ^*** |||| ||  ||   |   |||   | ||| |||  ||        || || ||  ||| |        |  ||  || ||   | |       | ||     | | ||| || || |||||||||||  | | |    | |    |  ||      |  ||   |||| ||  | | || | || ||| |||||||   || |||||||||| ..PS00001..      |||||||     ^***|  |   |  |    | |        || || |  |          ..||    || ||| ||   || | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         |  |     | |||||||| || | |||| |    |||||           || |||| ||  ||   |   |||   | ||| |||  ||        || || ||  ||| |        |  ||  || ||   | |       | ||     | | ||**^* || |||||||||||  | | |    | |    |  ||      |  ||   |||| ||  | | || | || ||| |||||||   || |||||||||| ..PS00004..      |||||||      |  |  |   |  |    | |        || || |  |          ..^*    || ||| ||   || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         |  |     | |||||||| || | |||| |    ^**||           || |||| ||  ||   |   ^**   | ^** |||  ||        || || ||  ||| |        |  ||  || ||   | |       ^**|     | | ^** |  || |||||||||||  | | |    ^**    |  ||      |  ||   |||| ||  | | || | || ||| |||||||   || |||||||||| ..PS00005..      |||||||      |  |  |   |  |    ^**        || || |  |          ..      || ||| ||   |^** 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         |  |     | |||||||| || | |||| |    ^***|           ^***||| ||  ||   |    |    |  || |||  ||        |^*** ||  |^***        |  ||  || ||   | |       | ||     | |  |  |  || |||||||||||  | | |    | |    |  ||      |  ||   |||| ||  | | || | |^***| |||||||   || |||||||||| ..PS00006..      |||||||      |  |  |   |  |    | |        || || |  |          ..      || ||| ||   |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         |  |     | |||||||| |^*****|| |     |  |            |  ||| ||  ||   ^*****    |  || ^*****|        |  || ||  ||| |        |  ||  || ||   | |       | ||     | |  |  |  || |||||||||||  | | |    | |    |  ||      |  ||   |||| ||  | | || | |  ||| |||||||   || |||||||||| ..PS00008..      |||||||      |  |  |   |  |    | |        || || |  |          ..      || ||| ||   |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         |  |     | |||||||| || | | || |     |  |            |  ||| ||  ||             |  || |||  ||        |  || ||  ||| |        |  ||  || ||   | |       ^***     | |  |  |  || |||||||||||  | | |    | |    |  ||      |  ||   |||| ||  | | || | |  ||| |||||||   || |||||||||| ..PS00009..      |||||||      |  |  |   |  |    | |        || || |  |          ..      || ||| ||   |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         |  |     *********| || | | || |     |  |            *****| ||  ||             |  || |||  ||        |  || ||  ||| |        *****  *****   | |       | |      | |  |  |  **********||||  | | |    | |    *****      *****   |||| ||  | | || | |  ||| ******|   ************* ..alphabetamotif..      *******      |  |  |   |  |    | |        ***** |  |          ..      *********   |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  |     | |||| ||| || | | || |     |  |            |  ||| ||  ||             |  || |||  ||        |  || ||  ||| |        |  |   || ||   | |       | |      | |  |  |  || |||||| ||||  | | |    | |    |  |       |  |    |||| ***** | || | |  ||| ||||| |   || || ||||||  ..asxmotif..      |||||||      |  |  |   |  |    | |        || || |  |          ..      || ||| ||   |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..         |  |     | |||| ||| || | | || |     |  |            |  ||| ||  **             |  || |||  **        |  || ||  ||| |        |  |   || ||   | |       | |      | |  |  |  || |||||| ||||  | | |    | |    |  |       |  |    ||||  |  | | || | |  ||| ||||| |   || || ||||||  ..betabulge..      |||||||      |  |  |   |  |    | |        || || |  |          ..      || ||| ||   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****     *********| || | **** |     ****            *********                 |  |****|            *******|  |****        ****   *****   | |       | |      | |  |  |  ********* ||||  | | |    | |    ****       ****    ||||  **** **** | ************ |   ************  ..betaturn..      ******|      |  |  |   ****    | |        ****| |  |          ..      *********   **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                           | || | | |  |                                               |  |  | |                |  |  | | |                       | |       | |      | |  |  |         |  |***  | | |    | |                       ||||         |  |      |   ||  |                 ..gammaturn..         |  |      |  |  |   |  |    | |         |  | |  |          ..                       
search RasMol script viewer Motif-ligand binding stats  nest ..                           ****** ***  |                                               |  |  ***                |  |  | | |                       ***       ***      | |  |  |         |  | |   | | |    | |                       ****         |  |      |   ||  |                 ..nest..         |  |      |  |  |   |  |    ***         |  | |  |          ..                       
search RasMol script viewer Motif-ligand binding stats  niche ..                                    ****                                               ****  ***                ******* ***                                          ***  ****         ******   *****    ***                                    ****      |   |****                 ..niche..         ****      *******   ****    | |         **** ****          ..                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                                                                                                                          *****                     ..ststaple..                                     | |                            ..                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                    ..stturn..                                     ***                            ..                       

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : DNA PRIMASE LARGE SUBUNIT
member of: PANTHER:searchPTHR10537/searchPTHR10537_SF3PFAM:searchPF04104PIRSF:searchPIRSF009449SUPERFAMILY:searchSSF140914UniProt:searchP49643
sec str:  ...................hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.....ee.hhhhhh.hhhhhhhhh..........eeeee...hhhhhh....eee..eeeeehhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhh......
sequence :  ..KLRLAG..YLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKF..PRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSL..LGFESIYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHL
seq num:  ..10    ..29        39        49        59        69        79   ..95        105       115       125       135       145       155       165      ..178       188       198       208       218       228       238       248   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      ..       ^*** ||  |||  |||  ||  ||   |  | |  |||| |  || |..               |  |  |  || |  |    | || |     |  |  | |     || | | || ||| ||   ..| ||  |   |  |    |||||                || || ||||| |  |||| | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ..         |  ||  |||  |||  ||  ||   |  | |  |||| |  || |..               |  |  |  || |  |    | || |     |  |  | |     || | ^**| ||| ||   ..| ||  |   |  |    |||||                || || ||||| |  |^** | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ..         ^***|  |||  |||  ||  ||   |  | |  ^*** |  || |..               |  |  |  || |  |    | || |     |  |  | |     ^*** ^*** ||| ||   ..| ||  |   |  |    |||||                || || ||||| |  | |  | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      ..             |  |||  |||  ||  ||   |  | |  |||  |  || |..               |  |  |  || |  |    | || |     |  |  | |      |   |    ||| ||   ..******^   |  |    |||||                || || ||||| |  | |  | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ..             |  |||  |||  ||  ||   |  | |  |||  |  || |..               |  |  |  || |  |    | || |     |  |  | |      |   |    ||| ||   ..***|      |  |    |||||                || || ||||| |  | |  | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      ..             |  |||  |||  ||  ||   |  | |  |||  |  || |..               |  |  |  || |  |    | || |     |  |  | |      |   |    ||| ||   ..|  |      |  |    ^***|                || || ||||| |  | |  | ||  |   |  || |
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..      ..             |  |||  |||  ||  ||   |  | |  |||  |  || |..               |  |  |  || |  |    | || |     |  |  | |      |   |    ||| ||   ..|  |      |  |     ||||                || || ||||| |  | |  | ||  |   |  |***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ..             *******************   |  | *****|  |  || |..               |  |  ***** |  |    | || |     |  |  | |      |   |    ||| ||   ..|  |      |  |     ||||                *********** |  | |  | ||  |   *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ..             **** **** ********    |  | **** *******| |..               |  |  ****  ****    ******     ****  | |      |   |    |****|   ..|  |      ****     ||||                **********  **** |  | ||  |   ****   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ..                                   |  |             | |..               |  |                  |  |           | |      |   |    | | ||   ..|  |               ||||                                 |  ***|  |          
search RasMol script viewer Motif-ligand binding stats  nest ..      ..                                   |  |             ***..               |  |                  |  |           ***      |   |    | | ||   ..|  |               ****                                 |  |  |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..      ..                                   ****                ..               ****                  ****                    |   |    | ****   ..****                                                    ****  ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..      ..                                                       ..                                                             *****    *****    ..                                                                            

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : DNA PRIMASE LARGE SUBUNIT
member of: PANTHER:searchPTHR10537/searchPTHR10537_SF3PFAM:searchPF04104PIRSF:searchPIRSF009449SUPERFAMILY:searchSSF140914UniProt:searchP49643
sec str:  ..............hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh.....ee.hhhhhh.hhhhhhhhh......eeee...hhhhhh....eee..eeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhh
sequence :  ..LQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQYQSKLESELRKLKFS..EPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSL..IYKIPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNH
seq num:  ..26        36        46        56        66        76       ..94        104       114       124       134       144       154       164       ..183       193       203       213       223       233       243       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  ||||    ^*** ||| |||  || ||  ||     |  | |  ||||||  || ||..         |  ||  || |  |  || |  ||  || || |    || ||| | |     || | |||||||||||   .. |   |  |    |||||  |  |          || || |||||||| || | | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||||      |  ||| |||  || ||  ||     |  | |  ||||||  || |^..         |  ||  || |  |  || |  ||  || || |    || ||| | |     || | ^**||||||||   .. |   |  |    |||||  |  |          || || |||||||| |^** | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||||      ^***|| |||  || ||  ||     |  | |  ^***||  || |^..         |  ||  || |  |  || |  ||  || || |    || ||| | |     ^*** ^***|||||||   .. |   |  |    |||||  |  |          || || |||||||| ||   | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  ||||          || |||  || ||  ||     |  | |  ||| ||  || | ..         |  ||  || |  |  || |  ||  || || |    || ||| | |      | | ||  |||||||   ..*^   |  |    |||||  |  |          || || |||||||| ||   | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||||          || |||  || ||  ||     |  | |  ||| ||  || | ..         |  ||  || |  |  || |  ||  || || |    || ||| | |      | | ||  |||||||   ..     |  |    |||||  |  |          || || |||||||| ||   | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  ||||          || |||  || ||  ||     |  | |  ||| ||  || | ..         |  ||  || |  |  || |  ||  || || |    || ||| | |      | | ||  |||||||   ..     |  |    ^***|  |  |          || || |||||||| ||   | ||  ||  |  || 
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  ||||          || |||  || ||  ||     |  | |  ||| ||  || | ..         |  ||  || |  |  || |  ||  || || |    || ||| | |      | | ||  |||||||   ..     |  |     ||||  |  |          || || |||||||| ||   | ||  ||  |  |**
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ||||          *****************     |  | ************* | ..         |  |***** |  ***** *****  || || |    ****** | |      | | ||  *****||   ..     |  |     ||||  |  |          *****************   | ||  ||  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ||||          ****************      |  | ************| | ..         ********  |  ****  ****   |**** |    *****  | |      | ****  ******|   ..     ****     ||||  ****          *****************   | ||  |*******  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ||||                                |  |             | | ..                |  |               |  || |           | |      |   |    | | ||   ..              ||||                                    ***|  |         
search RasMol script viewer Motif-ligand binding stats  nest ..  ****                                |  |             *** ..                |  |               |  || |           ***      |   |    | | ||   ..              ****                                       |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                                      ****                 ..                ****               |  ****                    |   |    | ****   ..                                                         ****         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                           ..                                   *****                      *****    *****    ..                                                                      

   New search    4bpu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors