triangle PDBeMotif: 4bdw  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.38
Classification hydrolase    | release date: Mon, Oct 8, 2012
Title the structure of the fni-egf tandem domain of coagulation fa in complex with holmium
Authors D.X.BERINGER, L.M.J.KROON-BATENBURG
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search HO HO binding statistics HO   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCD
VDTAA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COAGULATION FACTOR XIIA HEAVY CHAIN
member of: GENE3D:searchG3DSA_2.10.25.10PANTHER:searchPTHR24265/searchPTHR24265_SF75PFAM:searchPF00008/searchPF00039PIRSF:searchPIRSF001146PROSITE PATTERNS:searchPS00022/searchPS01186/searchPS01253, PROSITE PROFILES:searchPS50026/searchPS51091, SMART:searchSM00058/searchSM00130/searchSM00181SUPERFAMILY:searchSSF57196/searchSSF57440UniProt:searchP00748
JMol viewer RasMol script viewer  CL 1088A  .. *                                                                                 
JMol viewer RasMol script viewer  HO 1087A  .. |                                                                                 
JMol viewer RasMol script viewer  HO 1086A  .. |                                                                                *
sec str:  ....eee....eee....eeeee....eeeeee....eeeeee..ee..........eeee....eeee....ee.....ee...
sequence :  ..EKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGPFCDVDTAA
seq num:  ..3         13        23        33        43        53        63        73        83 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..**||   | |  |  |     |  |   | | | |  |          | |              | ||  |   ||||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****   | |  |  |     |  |   | | | |  |          | |              | ||  |   ||||    
search RasMol script viewer Motif-ligand binding stats  EGF_1 ..  |    | |  |  |     |  |   | | | |  |          | |              ^*^********^||    
search RasMol script viewer Motif-ligand binding stats  EGF_2 ..  |    | |  |  |     |  |   | | | |  |          | |              ^*^********^||    
search RasMol script viewer Motif-ligand binding stats  FN1_1 ..  ^*************************^*^******^          | |                 |  |   ||||    
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |  |  |     |  |       | |             ***                 |  |   ||||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  |  |     |  |       | |             | |                 ****   ||||    
search RasMol script viewer Motif-ligand binding stats  nest ..       ***  |  |     |  |       | |             | |                 |  |   ****    
search RasMol script viewer Motif-ligand binding stats  niche ..            ****     ****       ***             ***                 ****           

   New search    4bdw:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors