triangle PDBeMotif: 4asq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.15.1
Classification hydrolase    | release date: Wed, May 2, 2012
Title crystal structure of ance in complex with bradykinin
Authors E.D.STURROCK, G.MASUYER, K.R.ACHARYA, M.AKIF, R.E.ISAAC
Method X-RAY DIFFRACTION (resolution: 1.99Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search ZN ZN binding statistics ZN   search NAG NAG binding statistics NAG   search MAN MAN binding statistics MAN   search FLC FLC binding statistics FLC
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQ
FKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTA
VRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPM
HLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVC
HASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGL
LKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKY
HISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERI
MSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
Chain P sequence:
RPPGFSPFR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ANGIOTENSIN-CONVERTING ENZYME
member of: PANTHER:searchPTHR10514/searchPTHR10514_SF17PFAM:searchPF01401PRINTS:searchPEPDIPTASEASUPERFAMILY:searchSSF55486UniProt:searchQ10714
JMol viewer RasMol script viewer  FLC 1624A  ..                                                                                                                                                                                                                                                                                                                                  **                           *  *   *                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAG 1623A  ..                                    * * **                                                                                                                                                                                                                                                                               * *      ||                           |  |   |                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAG 1622A  ..                                    | | ||                                                                                                                                                                                                                                                            *                  | |      ||                           |  |   |                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  NAG 1616A  ..                                    | | ||                                                                                                                                         *                                                                                                                  |                  | |      ||                           |  |   |                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  BMA 1620A  ..                                    | | ||                         *                                                                                                               |                                                                                                                  |                  | |      ||                           |  |   |                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  ZN 1615A  ..                                    | | ||                         |                                                                                                               |                                                                                                                  |                  | |      ||                          *|  *   |                   *                                                                                                                                                                                                                           
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhee..........ee..hhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........ee.hhh.......hhhhhhhhh.........hhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhh...............eeee......eeee.....hhhhhhhhhhhhhhhhhhhhhh..hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhee....ee....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..........hhhhh....hhhhhhhhhhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh...........ee.
sequence :  ..ALVKEEIQAKEYLENLNKELAKRTNVETEAAWAYGSNITDENEKKKNEISAELAKFMKEVASDTTKFQWRSYQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFAKVKVCDYKDSTKCDLALDPEIEEVISKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFTSGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHLLGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWDKSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTALDKIVFLPFAFTMDKYRWSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEAFNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGWTTSNKCVS
seq num:  ..17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                   |   |  ||   |  ||^***  |  |   |             | || |  | |        |  |  |  |        |   |  |  |  |   | ||||||||      |  || ||| |    |             |  |          | |^*** ||     | | |                                |  ||  |      ||| ||||     |  | |  |         | ||||   |    |   | |^***     |  |  | | | |  | |||  || |            |   | |  ||  | |    |  ||| || | | ||          |  | | |  ||||  |             |  |                   |||||  |            | ||     | ||  |  | |  | | |  |                 ||||| ||    |  ||||||   |   |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                   |   |  ||   |  ||  ||  |  |   |             ^**| |  | |        |  |  |  |        |   |  |  |  |   | ||^**|||      |  || ||| |    |             |  |          | ||| | ||     | | |                                |  ||  |      ||| ||||     |  | |  |         | ||||   |    |   | | |       |  |  | | | |  | |||  || |            |   | |  ||  | |    |  ||| || | | ||          |  ^** |  ||||  |             |  |                   |||||  |            | ||     ^**|  |  | |  | | |  |                 ||||| ||    |  ||||||   |   |   | |  |         | |   ^**                || |||      ^**|  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   |   ^***|   |  ||  ||  |  |   |             |  | |  | |        |  |  |  |        |   ^***  |  |   | || ^***|      |  || ||| |    |             ^***          | ||| ^***     | | |                                |  ||  |      ||| ||||     |  | |  |         | ||||   |    |   | | |       |  ^*** | | |  | ||^***| |            |   | |  ||  | |    |  ||| || | | ||          |  |   |  ||||  |             ^***                   |||||  |            ^***     ^***  |  | |  | | |  |                 ||||| ||    |  ||||||   |   |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                   |   |   |   |  ||  ||  |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   | ||  || |      |  || |********^                           | ||| | |      | | |                                |  ||  |      ||| ||||     |  | |  |         | ||||   |    |   | | |       |  |    | | |  | ||    | |            |   | |  ||  | |    |  ||| || | | ||          |  |   |  ||||  |                                    |||||  |            | |      | ||  |  | |  | | |  |                 ||||| ||    |  ||||||   |   |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                   |   |   |   |  ^*****  |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   | ||  || |      |  || | | |                                | ||| | |      | | |                                |  ||  |      |^*****|     |  | |  |         | ||||   |    |   | | |       |  |    | | |  | ||    | |            |   | |  ||  | |    |  ||| || ^*****          |  |   |  ||||  |                                    |||||  |            | |      | ||  |  | |  | | |  |                 ||||| ||    |  ||||^*****   |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..                   |   |   |   |   |  |   |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   | ||  || |      |  || | | |                                | ||| | |      | | |                                |  ||  |      | | ||||     |  | |  |         | ||||   |    |   | | |       |  |    | | |  | ||    | |            |   | ***^^**^**    |  ||| ||   | |           |  |   |  ||||  |                                    |||||  |            | |      | ||  |  | |  | | |  |                 ||||| ||    |  |||| |       |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |   |   |   |   |  |   |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   | ||  || |      |  || | | |                                | ||| | |      | | |                                |  ||  |      | | ||||     |  | |  |         | ||||   |    |   | | |       |  |    | | |  | ||    | |            |   |     |         |  |*****   | |           |  |   |  ||||  |                                    |||||  |            | |      | ||  |  | |  | | |  |                 ||||| ||    |  |||| |       |   | |  |         | |   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   |   |   |   |   |  |   |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   ***|  || |      |  || | ***                                | ||| | |      | ***                                |  ||  |      | | ||||     |  | |  |         | ||||   |    |   | | |       |  |    | | |  | ||    | |            |   |     |         |  ||| ||   ***           |  |   |  ||||  |                                    |||||  |            | |      | ||  |  | |  | | |  |                 ||||***|    |  |||| |       |   | |  |         ***   | |                || |||      | ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |   |   |   |   |  |   |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   |  |  || |      |  || | |                                  ****| | |      | |                                  |  ||  |      | ****||     |  | |  |         ****||   |    |   | | |       |  |    | | |  | ||    | |            |   |     |         *********                 |  |   |  ||||  |                                    ||||****            | |      | ||  |  | |  | | ****                 |||||  |    |  |||| |       |   | |  |               | |                |****|      | ||  
search RasMol script viewer Motif-ligand binding stats  nest ..                   |   |   |   |   |  |   |  |   |             |  | |  | |        |  |  |  |        |   |     |  |   |  |  || |      |  || | |                                    *** | |      ***                                  |  ||  |      *** ****     |  | |  |           ***|   |    |   | ***       |  |    | | |  | ||    ***            |   |     |         |  |                      |  |   |  ****  |                                    ****                ***      | ||  |  | |  ***    |                 ****|  |    |  |||| |       |   | |  |               | |                |  ***      | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..                   |   |   |   |   |  |   |  |   |             **** ******        ****  ****        |   |     ****   **********      |  ******                                        | |                                           ********                   **** ****              |   |    |   |           ****    *****  ***|                   |   |     |         ****                      ****   |     ****                                                                 ****  **** |         |                     ****    *********       |   | ****               | |                |    |      ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                   |   |   |   |   |  |   |  |   |                                                  |   |                            |   |                                            | |                                                                                             |   |    |   |                            ||                   |   |     |                                      |   |                                                                          | |        |         |                                             |   |                    | |                ******      | |   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   |   |   |   |   |  *****  |   |                                                  |   |                            |   |                                            | |                                                                                             *****    |   |                            ||                   *****     |                                      *****                                                                          | |        |         |                                             |   |                    | |                            | |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   *********   *****         *****                                                  *****                            *****                                            | |                                                                                                      *****                            ||                             |                                                                                                                     | |        |         |                                             *****                    | |                            | |   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                      ***                                                                                                                                       ||                             |                                                                                                                     ***        |         |                                                                      ***                            ***   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                                                                                                                                                **                             *                                                                                                                                *         *                                                                                                           

chain P : BRADYKININ
member of: PANTHER:searchPTHR13814/searchPTHR13814_SF9UniProt:searchP01042
JMol viewer RasMol script viewer  FLC 1624A  ..*   
JMol viewer RasMol script viewer  ZN 1615A  ..*   
sec str:  ......
sequence :  ..RPPG
seq num:  ..1   

   New search    4asq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors