triangle PDBeMotif: 4ar5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification electron transport    | release date: Fri, Apr 20, 2012
Title x-ray crystallographic structure of the oxidised form perdeu pyrococcus furiosus rubredoxin in d2o at 295k (in quartz ca to 1.00 angstrom resolution.
Authors E.P.MITCHELL, M.G.CUYPERS, M.HAERTLEIN, M.P.BLAKELEY, S.A.MASON, V.T.FORSYTH
Method X-RAY DIFFRACTION (resolution: 1.00Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RUBREDOXIN
member of: CATH:search2.20.28.10GENE3D:searchG3DSA_2.20.28.10PANTHER:searchPTHR10909PFAM:searchPF00301PIRSF:searchPIRSF000071PRINTS:searchRUBREDOXINPROSITE PATTERNS:searchPS00202, PROSITE PROFILES:searchPS50903, SUPERFAMILY:searchSSF57802UniProt:searchP24297
JMol viewer RasMol script viewer  FE 1054A  ..     *  *                             *  *            
sec str:  ....eeee.....eee.....hhhh.....hhhhh...............eee...
sequence :  ..MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
seq num:  ..0         10        20        30        40        50  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  | |  |  || | ||||  ^***|||  | |  ||| |^***    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  | |  |  || | |^*****|| |||  | |  |^*****|     
search RasMol script viewer Motif-ligand binding stats  RUBREDOXIN ..     |  | |  |  || | ||||  ||| |******^**^*| |  |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  | |  ***** | ||||  |*****|  |    | | |  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     ******  |  |  | ||||  ||| |||  |    | | |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  ****  ****|*************    | | |  |     
search RasMol script viewer Motif-ligand binding stats  nest ..        ***          ***|  | |  ||  |    *** |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                        **** ********        ****     

   New search    4ar5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors