triangle PDBeMotif: 4a12  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Tue, Sep 13, 2011
Title structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator
Authors A.BUSCHIAZZO, D.ALBANESI, D.DE MENDOZA, M.E.GUERIN, P.M.ALZARI
Method X-RAY DIFFRACTION (resolution: 3.15Å)
PDBe Citation   
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIG
DLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQT
AKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTION FACTOR FAPR
member of: GENE3D:searchG3DSA_3.10.129.10HAMAP:searchMF_01814PFAM:searchPF03061PIRSF:searchPIRSF037733SUPERFAMILY:searchSSF54637UniProt:searchQ2FZ56
sec str:  ....hhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhh.....hhhhh....eeeeee...eeeeeee.............hhhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeeeeeeeee...eeeeeeeee....eeeeeeeeeeee...
sequence :  ..KLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|             |  |  ||  |    | |   | |   | | |       |      |   ||||||      || | |||  |  | || ||   |||   |          |  |                  | ^***|     |^***||             ||            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*             |  |  ||  |    | |   ^**   | | |       |      |   ||||||      || | |||  |  | || ||   |||   |          |  |                  |  |^**     || ^**|             ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..              |  |  |^***    | |     |   | | |       |      |   ^***||      || | |||  ^*** || ||   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              |  |  |        | |     |   | | |       *******^    || ||      || | |||       || ||   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              |  |  |        | |     |   | | |                   || ||      || | |||       || ||   |^*****          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  betabulge ..              |  |  |        | |     |   | | |                   || ||      ** | |||       || ||   | |              |  |                  |  |        ** |  |             **            
search RasMol script viewer Motif-ligand binding stats  betaturn ..              |  |  |        | |     |   | | |                   ****|         ****|       ****|   | |              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |  |        ***     |   | ***                    |  |           ***        |  |   ***              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..              *******                |   |                        ****                      ****                    ****                  ****           ****                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                     *****                                                                                                                                              

chain B : TRANSCRIPTION FACTOR FAPR
member of: GENE3D:searchG3DSA_3.10.129.10HAMAP:searchMF_01814PFAM:searchPF03061PIRSF:searchPIRSF037733SUPERFAMILY:searchSSF54637UniProt:searchQ2FZ56
sec str:  .......hhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhh...eeeeee...eeeeeee.............hhhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeeeeeeeee...eeeeeeeee....eeeeeeeeeeee...
sequence :  ..ETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |             |  |  ||  ||   | ||  |||   | | |       |      || ||  ||  |    || | |||  |  |  |  |   |||   |          |  |                  | ^***|     |^***||             ||            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**             |  |  ||  ||   | ||  ^**   | | |       |      || ||  ||  |    || | |||  |  |  |  |   |||   |          |  |                  |  |^**     || ^**|             ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |  |  |^***|   | ||   ||   | | |       |      || |^***|  |    || | |||  ^***  |  |   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                 |  |  ||   |   | ||   ||   | | |       *******^| |    |  |    || | |||        |  |   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  |  ||   |   | ||   ||   | | |               | |    |  |    || | |||        |  |   |^*****          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |  ||   |   | ||   ||   | | |               | |    |  |    ** | |||        |  |   | |              |  |                  |  |        ** |  |             **            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |  ||   |   | ||   ||   | | |               | |    |  |       ****|        |  |   | |              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |  ||   |   ***|   ||   | ***               ***    |  |         ***        |  |   ***              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                 *******|   |      |   ||   |                          ****                    ****                    ****                  ****           ****                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****      *****|   |                                                                                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        *****                                                                                                                                              

chain C : TRANSCRIPTION FACTOR FAPR
member of: GENE3D:searchG3DSA_3.10.129.10HAMAP:searchMF_01814PFAM:searchPF03061PIRSF:searchPIRSF037733SUPERFAMILY:searchSSF54637UniProt:searchQ2FZ56
sec str:  .......hhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhh...eeeeee...eeeeeee.............hhhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeeeeeeeee...eeeeeeeee....eeeeeeeeeeee...
sequence :  ..ETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |             |  |  ||  ||   | ||  |||   | | |       |      || ||| ||| |    || | |||  |  |  |  |   |||   |          |  |                  | ^***|     |^***||             ||            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**             |  |  ||  ||   | ||  ^**   | | |       |      || ||| ||| |    || | |||  |  |  |  |   |||   |          |  |                  |  |^**     || ^**|             ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |  |  |^***|   | ||   ||   | | |       |      || |^***|| |    || | |||  ^***  |  |   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                 |  |  ||   |   | ||   ||   | | |       *******^| | |  || |    || | |||        |  |   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                 |  |  ||   |   | ||   ||   | | |               | | |  || |    || | |||        |  |   |^*****          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  betabulge ..                 |  |  ||   |   | ||   ||   | | |               | | |  || |    ** | |||        |  |   | |              |  |                  |  |        ** |  |             **            
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |  ||   |   | ||   ||   | | |               | | |  || |       ****|        |  |   | |              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |  ||   |   ***|   ||   | ***               *** |  || |         ***        |  |   ***              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                 *******|   |      |   ||   |                       |  ****                    ****                    ****                  ****           ****                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        *****      *****|   |                       *****                                                                                                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        *****                                                                                                                                              

chain D : TRANSCRIPTION FACTOR FAPR
member of: GENE3D:searchG3DSA_3.10.129.10HAMAP:searchMF_01814PFAM:searchPF03061PIRSF:searchPIRSF037733SUPERFAMILY:searchSSF54637UniProt:searchQ2FZ56
sec str:  ....hhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhhhh.....hhhhh....eeeeee...eeeeeee.............hhhhhhhhhhhhhhhhh...eeeeeeeeee.........eeeeeeeeeee...eeeeeeeee....eeeeeeeeeeee...
sequence :  ..KLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIKLVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANSLCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKGNFKMFYDKRG
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|           | | ||  ||  ||   | |   | |   | | |       |      |   ||||||      || | |||  |  | || ||   |||   |          |  |                  | ^***|     |^***||             ||            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*           | | ||  ||  ||   | |   ^**   | | |       |      |   ||||||      || | |||  |  | || ||   |||   |          |  |                  |  |^**     || ^**|             ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | | ||  |^***|   | |     |   | | |       |      |   ^***||      || | |||  ^*** || ||   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..            | | ||  ||   |   | |     |   | | |       *******^    || ||      || | |||       || ||   |||   |          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | | ||  ||   |   | |     |   | | |                   || ||      || | |||       || ||   |^*****          |  |                  |  |        || |  |             ||            
search RasMol script viewer Motif-ligand binding stats  betabulge ..            | | ||  ||   |   | |     |   | | |                   || ||      ** | |||       || ||   | |              |  |                  |  |        ** |  |             **            
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | ||  ||   |   | |     |   | | |                   ****|         ****|       ****|   | |              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  nest ..            | | ||  ||   |   ***     |   | ***                    |  |           ***        |  |   ***              |  |                  |  |           |  |                           
search RasMol script viewer Motif-ligand binding stats  niche ..            | *******|   |           |   |                        ****                      ****                    ****                  ****           ****                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..            |   |    *****           |   |                                                                                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                    *****                                                                                                                                              

chain F : FAPR PROMOTER
sec str:  ..........................................
sequence :  ..GCCAATTATATACTACTATTAGTACCTAGTCTTAATTCCG
seq num:  ..1         11        21        31        

chain G : FAPR PROMOTER
sec str:  ..........................................
sequence :  ..CGGAATTAAGACTAGGTACTAATAGTAGTATATAATTGGC
seq num:  ..1         11        21        31        

   New search    4a12:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors