triangle PDBeMotif: 3zyq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling    | release date: Wed, Aug 24, 2011
Title crystal structure of the tandem vhs and fyve domains of hepa growth factor-regulated tyrosine kinase substrate (hgs-hrs) a resolution
Authors A.BULLOCK, A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, F.VON, J.R.C.MUNIZ, J.WEIGELT, L.SHRESTHA, M.VOLLMAR, T.KROJER, V.AYINAMPUDI
Method X-RAY DIFFRACTION (resolution: 1.48Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search SO4 SO4 binding statistics SO4   search EDO EDO binding statistics EDO
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SMGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTV
HDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPD
WVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNRKAEG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE KINASSUBSTRATE;
member of: CATH:search1.25.40.90/search3.30.40.10GENE3D:searchG3DSA_1.25.40.90/searchG3DSA_3.30.40.10PANTHER:searchPTHR13856/searchPTHR13856_SF79PFAM:searchPF00790/searchPF01363PIRSF:searchPIRSF036956PROSITE PROFILES:searchPS50178/searchPS50179, SMART:searchSM00064/searchSM00288SUPERFAMILY:searchSSF48464/searchSSF57903UniProt:searchO14964
JMol viewer RasMol script viewer  EDO 1226A  ..                                                                                                                                                                          *** *                                         
JMol viewer RasMol script viewer  EDO 1225A  ..    *  **                                                                                                                                                                 ||| |                                         
JMol viewer RasMol script viewer  SO4 1224A  ..    |  ||                                                                                                                                                                 ||| ** *                                      
JMol viewer RasMol script viewer  ZN 1223A  ..    |  ||                                                                                                                                                                 ||| ||**                          *  *      
JMol viewer RasMol script viewer  ZN 1222A  ..    |  ||                                                                                                                                                       *  *      ||| |||| |    *  *                  |  |      
sec str:  ..hhhhhhhhhhh.......hhhhhhhhhhhhhh...hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhh............................ee......ee......eeeeehhhheeeeeeehhhhhhhhh.
sequence :  ..GTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNR
seq num:  ..6         16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | | || ||  |  |          ||||       ^** |  | | |                  || ||| |  || |    |  |                   |  |  |         || |||     | || |                 | |     ^**     |||  ||  ^**    | ||| |  |     |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | | || ||  ^***          ||||           |  | | |                  ^***|| |  ^***    |  |                   |  |  |         || |||     | || |                 | |             |||  ||  |      | ||| |  |     |     
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | | || ||                ||||           |  | | |                   |  || |   |      |  |                   |  |  |         || |||     | || |                 | |             |||  ||  |      | ||| |  ******^     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | | || ||                ||||           |  | | |                   |  || |   |      |  |                   |  |  |         || |||     | || |                 | |             |^*****  |      | ||| |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | | || ||                ||||           |  | | |                   ***** |   |      |  |                   |  |  |         || |||     | || |                 | |             | |  |   |      | ||| |              
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | | || ||                ||||           |  | | |                   |  |  *****      |  |                   |  |  |         || |||     | || |                 | |             | |  |   |      | ||| |              
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | | || ||                ||||           |  *****                   |  |             |  |                   |  |  |         || |||     | || |                 | |             | |  |   |      | ||| |              
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | | || ||                ||||           |  | |                     ****             |  |                   *******         |****|     **** |                 | |             | |  |   |      ****| |              
search RasMol script viewer Motif-ligand binding stats  nest ..      | | || ||                ****           |  | |                                      |  |                   |  |            |  ***       |  |                 ***             ***  |   |        *** |              
search RasMol script viewer Motif-ligand binding stats  niche ..      | *******                               ******                                      ****                   ****            |    |       ****                                      |   |          ***              
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..      |   || |                                                                                                                   ******                                                 |   |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..      *****| |                                                                                                                                                                          *****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                                                                                                                                          

   New search    3zyq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors