triangle PDBeMotif: 3zwh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification ca-binding protein/motor protein    | release date: Sun, Jul 31, 2011
Title ca2+-bound s100a4 c3s, c81s, c86s and f45w mutant complexed with myosin iia
Authors A.DUELLI, A.K.KEKESI, B.KISS, G.KATONA, L.NYITRAY, L.RADNAI
Method X-RAY DIFFRACTION (resolution: 1.94Å)
PDBe Citation   
Small molecules:    search ACT ACT binding statistics ACT   search AZI AZI binding statistics AZI   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GSHMASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCV
FLSSIAMMSNEFFEGFPDKQPRKK
Chain Q sequence:
YRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN S100-A4
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR11639/searchPTHR11639_SF15PFAM:searchPF01023PROSITE PATTERNS:searchPS00018/searchPS00303, PROSITE PROFILES:searchPS50222, SUPERFAMILY:searchSSF47473UniProt:searchP26447
JMol viewer RasMol script viewer  AZI 1100B  ..                                                                                             
JMol viewer RasMol script viewer  ACT 1096A  ..                                            **       *                                       
JMol viewer RasMol script viewer  ACT 1095A  ..                                 *          *|       |                                       
JMol viewer RasMol script viewer  CA 502A  ..                                 |          ||       |       * * * *    *                    
JMol viewer RasMol script viewer  CA 501A  ..                  *  * *  *    * |          ||       |       | | | |    |                    
sec str:  ...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..ASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFP
seq num:  ..2         12        22        32        42        52        62        72        82        92 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||             | || | || ^***|        |  |  |        | |  ||||||| |  ||   |  |   |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||             ^**| | || |   |        |  |  |        | |  |^**||| |  ||   |  |   |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***             ^*** | || |   |        |  |  |        | ^***^***|| |  ||   |  |   |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..** |              |  | | || |   |        |  |  |        |    | ||||| |  ||   |  |   |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION .. | |              |  | | || |   |        |  ^***        |    | ||||| |  ||   |  |   |        
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 .. | |              |  | | || |   |        |  |           |    ^*^*^*^*^**^*   |  |   |        
search RasMol script viewer Motif-ligand binding stats  S100_CABP .. | |              |  | | || |   |        |  |           **********************  |   |        
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |              |  | | || *****        |  |                  |||||            |   |        
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |              |  | ***|              |  |                  |||||            |   |        
search RasMol script viewer Motif-ligand binding stats  nest .. | |              |  | |  |              |  |                  *****            |   |        
search RasMol script viewer Motif-ligand binding stats  niche .. | |              **** ****              ****                                   |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple .. | |                                                                            *****        
search RasMol script viewer Motif-ligand binding stats  stturn .. ***                                                                                         

chain B : PROTEIN S100-A4
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR11639/searchPTHR11639_SF15PFAM:searchPF01023PROSITE PATTERNS:searchPS00018/searchPS00303, PROSITE PROFILES:searchPS50222, SUPERFAMILY:searchSSF47473UniProt:searchP26447
JMol viewer RasMol script viewer  AZI 1100B  ..   *                                                                                               
JMol viewer RasMol script viewer  CA 502B  ..   |                                                          * * * *                              
JMol viewer RasMol script viewer  CA 501B  ..   |               *  * *  *    *                             | | | |                              
sec str:  ....hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.......
sequence :  ..MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPDKQPR
seq num:  ..1         11        21        31        41        51        61        71        81        91       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | ||   ||  ||    | || | || ^***|        |  || | |      | |  ||||||| |  ||   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | ||   ||  ||    ^**| | || |   |        |  || | |      | |  |^**||| |  ||   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ^***   ||  ||    ^*** | || |   |        |  || | |      | ^***^***|| |  ||   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..*** |    ||  ||    |  | | || |   |        |  || | |      |    | ||||| |  ||   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | |    ||  ||    |  | | || |   |        |  ^*** |      |    | ||||| |  ||   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 ..  | |    ||  ||    |  | | || |   |        |  || | |      |    ^*^*^*^*^**^*   |          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  S100_CABP ..  | |    ||  ||    |  | | || |   |        |  || | |      **********************          |  ||  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | |    ||  ||    |  | | || *****        |  || | |             |||||                    |  ||  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | |    ||  ||    |  | ***|              |  || | |             |||||                    |  ||  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | |    ||  ||    |  | |  |              |  || | |             *****                    |  ||  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  | |    ||  ||    **** ****              *********                                      ********  
search RasMol script viewer Motif-ligand binding stats  ststaple ..  | |    ******                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***                                                                                              

chain Q : MYOSIN-9
member of: PANTHER:searchPTHR13140/searchPTHR13140_SF317PFAM:searchPF01576UniProt:searchP35579
JMol viewer RasMol script viewer  AZI 2936Q  ..                           **  **** *      
JMol viewer RasMol script viewer  ACT 1096A  ..                           ||  |||| |      
sec str:  .......hhhhhhh..hhhhhhhhhhhhhhhhh............
sequence :  ..YRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMA
seq num:  ..1893      1903      1913      1923         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | ||  |           ^**    ||||  |      
search RasMol script viewer Motif-ligand binding stats  RGD ..     | ||  |                  ***|  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |****                  |||****      
search RasMol script viewer Motif-ligand binding stats  nest ..     ***   |                  ****  |      
search RasMol script viewer Motif-ligand binding stats  niche ..       |   |                     ****      
search RasMol script viewer Motif-ligand binding stats  ststaple ..       *****                               

   New search    3zwh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors