triangle PDBeMotif: 3wap  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein transport    | release date: Mon, May 6, 2013
Title crystal structure of atg13 lir-fused human lc3c_8-125
Authors E.MORITA, H.SUZUKI, K.TABATA, M.KAWASAKI, R.C.J.DOBSON, R.KATO, S.WAKATSUKI, T.YOSHIMORI
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSSSGNTHDDFVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLS
IIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AUTOPHAGY-RELATED PROTEIN 13, MICROTUBULE-ASSOCIAPROTEINS 1A/1B LIGHT CHAIN 3C;
member of: GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10969/searchPTHR10969_SF24PFAM:searchPF02991SUPERFAMILY:searchSSF54236UniProt:searchQ9BXW4
sec str:  ..................hhhhhhhhhhhhhhhh...eeeeeee.............eeee....hhhhhhhhhhh..........eeee..........hhhhhhhhh......eeeeee.....
sequence :  ..FVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | || ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | ^*** | ||| |||||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ^**| ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | |||  | ||| |||||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | |||  | ||^***|||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | ||||            |  |  |       |  |  |    | |            |  ||    |******^  | |||  | ||| | |||  *******^         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ||||            |  |  |       |  |  |    | |            |  ||    ||| |     | |||  | ||| | |||  |  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****|            |  |  |       |  |  |    | |            *****    ||| |     | |||  | ||| *****  |  | |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          | || |            |  |  |       |  |  |    | |            |  |     ||| |     *****  | ||| | |||  |  | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..          **** |            |  |  |       |  |  |    | |            ****     ||| |     ****|  | ||| ****|  |  | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |            |  |  |       |  |  |    | |                     *** |       ***  | |||   | |  |  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..            ****            *******       *******    ***                      ****            ****|   | ****  ***           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                              | | *****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ***                           

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AUTOPHAGY-RELATED PROTEIN 13, MICROTUBULE-ASSOCIAPROTEINS 1A/1B LIGHT CHAIN 3C;
member of: GENE3D:searchG3DSA_3.10.20.90PANTHER:searchPTHR10969/searchPTHR10969_SF24PFAM:searchPF02991SUPERFAMILY:searchSSF54236UniProt:searchQ9BXW4
sec str:  ..................hhhhhhhhhhhhhhhh...eeeeeee.............eeee....hhhhhhhhhhh..........eeee..........hhhhhhhhh......eeeeee.....
sequence :  ..FVMIGSPSVRPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLVPQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKDEDGFVYMTYASQETF
seq num:  ..11        21        31        41        51        61        71        81        91        101       111       121       131 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | || ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | ^*** | ||| |||||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ^**| ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | |||  | ||| |||||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | ||||            |  |  |       |  |  |    | |            |  ||    ||| |  |  | |||  | ||^***|||  |  | | |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | ||||            |  |  |       |  |  |    | |            |  ||    |******^  | |||  | ||| | |||  *******^         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ||||            |  |  |       |  |  |    | |            |  ||    ||| |     | |||  | ||| | |||  |  | |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****|            |  |  |       |  |  |    | |            *****    ||| |     | |||  | ||| *****  |  | |           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..          | || |            |  |  |       |  |  |    | |            |  |     ||| |     *****  | ||| | |||  |  | |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..          **** |            |  |  |       |  |  |    | |            ****     ||| |     ****|  | ||| ****|  |  | |           
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |            |  |  |       |  |  |    | |                     *** |       ***  | |||   | |  |  | |           
search RasMol script viewer Motif-ligand binding stats  niche ..            ****            *******       *******    ***                      ****            ****|   | ****  ***           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                              | | *****                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                              ***                           

   New search    3wap:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors