triangle PDBeMotif: 3w3k  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immune system    | release date: Sat, Dec 22, 2012
Title crystal structure of human tlr8 in complex with cl075
Authors H.TANJI, T.SHIMIZU, U.OHTO
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search L07 L07 binding statistics L07   search MAN MAN binding statistics MAN
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
RSPWEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQH
QNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCY
FNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFN
APFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEIL
DLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEI
IYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFE
NLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQN
FTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNL
PASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLD
LSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTC
VSDVTEFLVPR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TOLL-LIKE RECEPTOR 8
member of: GENE3D:searchG3DSA_3.80.10.10PANTHER:searchPTHR24365/searchPTHR24365_SF227PFAM:searchPF13516/searchPF13855PROSITE PROFILES:searchPS51450, SMART:searchSM00082/searchSM00369SUPERFAMILY:searchSSF52047/searchSSF52058UniProt:searchQ9NR97
JMol viewer RasMol script viewer  NAG 908B  ..         ..                                                        ..                                                                                                                                                                                                                                                                                                                                  ..NAG ..                                                                                                                                                                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  L07 901B  ..         ..                                                        ..                                                                                                                                                                                                                                           *    *                        *                          *                             ..L07 ..                                                                                                                                                                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  NAG 917A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                                                                                                                                                     ** *                            *                                                                                                                                                                                 
JMol viewer RasMol script viewer  NAG 916A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                                                                                                                                                     || |                            |               *                     * * **                                                                                                                                      
JMol viewer RasMol script viewer  BMA 913A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..BMA ..                   *                                                                                                                                 || |                            |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 912A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                 * *                                                       *                                                                         || |                            |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 911A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                 * |                                                       |                         *                           * *                 || |* *                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 910A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                 | |                                           *           |           *             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  BMA 909A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..BMA ..                 | |                                           |           |           |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 908A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                 | |                                           |           |           |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 907A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..NAG ..                 * |*         **                    * *        |           * *         |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  BMA 904A  ..         ..                                                        ..                                                                                                                                                                                                                                           |    |                        |                          |                             ..BMA ..     *           | ||         ||                    | |        |           | |         |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 903A  ..         ..                                                        ..                                                                                                                 *                       *                                        *                                                        |    |                        |                          |                             ..NAG ..     **          | ||         ||                    | |        |           | |         |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  NAG 902A  ..         ..                                                        ..                                                                                                                 |   *                   | * *                                    * *                                                      |    |                        |                          |                             ..NAG ..     ||***       | ||         ||                    | |        |           | |         |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  MAN 905A  ..         ..                                                        ..                                                                                                                 |   |                   | | |                                    | |                                                      |    |                        |                          |                             ..MAN ..     |||||       | ||         ||                    | |        |           | |         |             |                           | |                 || || |                         |               |                     | | ||                                                                                                                                      
JMol viewer RasMol script viewer  L07 901A  ..         ..                                                        ..                                                                                                                 |   |                   | | |                                    | |                                                      |    |                        |                          |                             ..L07 ..     |||||       | ||         ||                    | |        |           | |      * *|             |           ***             | |                 || || |                         |               |                     | | ||                                                                                                                                      
sec str:  ........ee....eee..................eee.......ee............eee...........ee............eee..................eee.......eehhhhhh......eee..............ee............eee..................eee.......ee............eee.................hhhhh..ee............eee.........hhhhhh......eee.....hhhhhhhhhhhhhh....eee................hhhhhhh....eee.......eehhhhhhhhh......eee.......ee.hhhhhhh....eee............. ...................hhhhhh...eee.....................eee......................eee.....................eee...hhhhhh.......hhhhhhh....eee.....................eee....hhhhhh..................eee.........hhhhhhh......eee.........hhhhhhhh....eee...........hhhhh.....eee.....................eee.........hhhhhh........eee........hhhhhhhhhhhhhh......hhhhh...........hhhhh
sequence :  ..SRSYPCDEK..VIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNV..GLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEIIYLSENRISPLV... ..FEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSL
seq num:  ..31       ..45        55        65        75        85        95    ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423         ... ..459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..** | |   ..*  | |||||   |  ||  ||  | | | |   |^***  | ^*** | |     ..| ^***| |  |  |  |   ||||     | | || ||| | | | ^***  |  |  |   | || ||| |    |  | | |  || || || |   | |     | ||| || |||||   |  ||  | ^*** ||| |  ||| |      |  |    ||  |  ^***| | ^***||||  | |    |  |   | |     |   ||||  ||  |   | || ||  |     ^***^***| |||  | |||||          |  | ^*** | |||||       | ^*** |  | | | |    ..PS00001.. | |  ||  || |   |  ||      | | | |     | || |      ^***||| |  ||||  ||  |   | | | || |^***||||| ||  | || | |  |  |      | ^***|   ^***||| | |||    | || | | |     |  | |||   | || | ^*** | |||||       |  || || | | | | |   ^***   |  |  || | | |  || |||||| |||  | |         | |  | |||  | | | |   ^*** |   |||||  ||| |    || ||        |  |   ||| |   | |||| || |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |   ..   | |||||   |  ||  ||  | | | |   |  ||  |  |   | |     ..|     | |  |  |  |   ||||     | | || ||| | | |       |  |  |   | || ||| |    |  | | |  || || || |   | |     | ||| || |||||   |  ||  |  ||  ||| |  ||| |      |  |    ||  |   |  | | | ||||||  | |    |  |   | |     |   ||||  ||  |   | || ||  |         || || |||  | |||||          |  |  |   | |||||       |  ||  |  | | | |    ..PS00004.. | |  ||  || |   |  ||      | | | |     | || |      | ||||| |  ||||  ||  |   | | | || || ||||||| ||  | || | |  |  |      |  |  |   | ||||| | |||    | || | | |     |  | |||   | || |  ||  | |||||       |  || || | | | | |   | ||   |  |  || | | |  || |||||| |||  | |         | |  | |||  | | | |     |  |   |||||  ||| |    || ||        |  |   ||| |   | |||| || |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |   ..   | ^**||   |  ||  ||  | | | |   |  ||  |  |   | |     ..|     | |  |  |  |   ||||     | | || ||| | | |       |  |  |   | || ||| |    |  | | |  || || || |   | |     | ^** || |||||   |  ||  |  ||  ||| |  ||| |      |  |    ||  |   |  | | | |||^**  | |    |  |   | |     |   ||||  ||  |   | || ||  |         || || ^**  | |||||          |  |  |   | |||||       |  ||  |  | | | |    ..PS00005.. | |  ||  || |   |  ||      | | | |     | || |      | ||||| |  ||||  ||  |   | | | || || ||||||| ||  | || | |  |  |      |  |  |   | ||||| | ^**    | || | | |     |  | |||   | || |  ||  | |||||       |  || || | | | | |   | ||   |  |  || | | |  || |||||| ^**  | |         | |  | ^**  | | | |     |  |   ^**||  ||| |    || ||        |  |   ||| |   | |||| || |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |   ..   | |||||   |  ||  |^*** | | |   |  ||  |  |   | |     ..|     | |  |  |  |   ||||     | | ^***|| | | |       |  |  |   | || ||| |    ^*** | |  |^*** || |   | |     |  |  || |||||   ^***|  |  |^***|| |  ||| |      |  |    ||  |   |  | | | |||||   | |    |  |   | |     |   ||||  ||  |   | || ||  |         || ||  |   | |||||          |  |  |   | |||||       |  |^***  | | | |    ..PS00006..** |  ||  || |   |  ||      | | | |     | || |      | ||||| |  ^***  ||  |   | | | || || ||||||^***  | || | |  |  |      |  |  |   | ||||| ^***     | ^*** | |     |  | |||   | || |  |^*** |||||       |  || ^*** | | | |   | ||   |  |  || | | |  || ^***|| ||   | |         | |  |  |   | | | |     ^***    | |^***|| |    || ||        |  |   ||| |   ^***|| || |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |   ..   | |||||   |  ||  |   | | | |   |  ||  |  |   | |     ..*     ^*****  |  |   ||||     ^*****  || | | |       |  |  |   | || ||| |         ^*****  |  || |   | |     |  |  || |||||       |  |  |   ||| |  ||| |      |  ^*****|  |   |  | | | |||||   | |    |  |   | |     |   |^*****|  |   | || ||  |         || ||  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..PS00008..   |  ||  || |   |  ||      | | | |     | || |      | ||||| |  |^*****|  |   | | | || || ||||||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  | |||   | || |  |   | |||||       |  ||  |   | | | |   | ||   |  |  || | | |  || |||||| ||   | |         | |  |  |   | | | |     |  |    | |   ||| |    || ||        |  |   ||| |     | || || |||
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..   | |   ..   | |||||   |  ||  |   | | | |   |  ||  |  |   | |     ..      | |  |  |  **********************| | | |       |  |  |   | || ||| |         | |  |  |  **********************| |||||       |  |  |   ||| |  ||| |      |  |     |  |   |  | | | |||||   | |    |  |   | |     |   ||||   |  |   | || ||  |         || ||  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..PS00029..   |  ||  || |   |  ||      | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ||||||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  | |||   | || |  |   | |||||       |  **********************   |  |  **********************   | |         | |  |  |   | | | |     |  |    | |   ||| |    || ||        |  |   ||| |     | || || |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |   ..   | |||||   |  ||  |   | | | |   |  ||  |  |   | |     ..      | |  |  |      ||||       |  |   | | | |       |  |  |   | || ||| |         | |  |  |   | |   | |     |  |   | |||||       |  |  |   ||| |  ||| |      |  |     |  |   |  | | | |||||   | |    |  |   | |     |   ||||   |  |   | || ||  |         || ||  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..alphabetamotif..   |  ||  || |   *****      | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ||||||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  | |||   | || |  |   | |||||       |  ||  |   | | | |   | |    |  |   | | | |  || |***** ||   | |         | |  |  |   | | | |     |  |    | |   ||| |    || ||        |  |   ||| |     | || || |||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   | |   ..   | |||||   |  ||  |   | | | |   |  ||  |  |   | |     ..      | |  |  |      ||||       |  |   | | | |       |  |  |   | || ||| |         | |  |  |   | |   | |     |  |   | |||||       |  |  |   ||| |  ||| |      |  |     |  |   |  | | | |||||   | |    |  |   | |     |   ||||   |  |   | || ||  |         || ||  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..asxmotif..   |  ||  || |   |  |       | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ||||||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  *****   | || |  |   | |||||       |  ||  |   | | | |   | |    |  |   | | | |  || |||||| ||   | |         | |  |  |   | | | |     |  |    | |   ||| |    || ||        |  |   ||| |     | || || |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |   ..   | |||||   |  ||  |   *** | |   |  ||  |  |   ***     ..      | |  |  |      ||||       |  |   | | | |       |  |  |   | || ||| |         | |  |  |   | |   | |     |  |   | |||||       |  |  |   ||| |  ||| |      |  |     |  |   |  | | | |||||   ***    |  |   | |     |   ||||   |  |   ***| ||  |         || ||  |   | |||||          |  |  |   ***||||       |  |      | | | |    ..asxturn..   |  ||  || |   |  |       *** | |     | || |      ***|||| |  ||||   |  |   *** | || |***|||||  |   ***| | |  |  |      |  |  |   ***||||          | ||   | |     |  ***|    | || |  |   ***||||       |  ||  |   | | | |   ***    |  |   | | | |  || |||||| ||   | |         | |  |  |   | | | |     |  |    | |   ||| |    || ||        |  |   ||| |     | || || |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |   ..   | |||||   |  ||  |   | | | |   ********  |   | |     ..      | |  |  |      ||||       |  |   | | | |       |  |  |   | || |****         | ****  |   | |   | |     |  |   | |||||       |  |  |   ||| |  ||| |      ****     ****   **** | | |||||          |  |   | |     |   ||||   |  |   | || |****         ****|  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..betaturn..   |  ||  || |   ****       | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ****||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  ****    **** |  |   | |||||       |  ||  |   | | | |          |  |   | | | |  || *****| ||   | |         | |  |  |   | | | |     ****    | |   ||| |    *****        |  |   ||| |     | ********|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |   ..   | |||||   |  ||  |   | | | |       |  |  |   | |     ..      | |  |  |      ||||       |  |   | | | |       |  |  |   | || | | |         | |  |  |   | |   | |     |  |   | |||||       |  |  |   ||| |  ||| |                      |  | | | |||||          |  |   | |     |   ||||   |  |   | || ||  |          |  |  |   | |||||          |  |  |   | |||||       |  |      | | | |    ..gammaturn..   |  ||  || |              | | | |     | || |      | ||||| |  ||||   |  |   | | | |***|  || ||  |   | || | |  |  |      |  |  |   | |||||          | ||   | |     |  |  |      |  |  |   | |||||       |  ||  |   | | | |          |  |   | | | |  || | |  | ||   | |         | |  |  |   | | | |     |  |    | |   ||| |                 |  |   ||| |     | || || | |
search RasMol script viewer Motif-ligand binding stats  nest ..   | |   ..   | |****   |  ||  |   | | | |       |  |  |   | |     ..      ***  |  |      ****       |  |   | | | |       |  |  |   | |*** | |         ***  |  |   | |   ***     |  |   | |****       |  |  |   ||| |  ||| |                      |  | | | |****          |  |   | |     |   ****   |  |   | |***|  |          |  |  |   | |****          |  |  |   | |****       |  |      | | | |    ..nest..   |  ||  || |              | | | |     | || |      | |**** |  ****   |  |   | | | |   |  |***|  |   | |*** |  |  |      |  |  |   | |****          | ||   | |     |  |  |      |  |  |   | |****       |  ||  |   | | | |          |  |   | | | |  || | |  | ||   | |         ***  |  |   | | | |     |  |    | |   ||| |                 |  |   *** |     | || || | |
search RasMol script viewer Motif-ligand binding stats  niche ..   ***   ..   ***       ********   *** ***       *******   ***     ..        *******                 ****   *** ***       *******   ***    ***           *******   ***           ****   ***           *******   *****  *****                      ****** ***              ****   ***     |   |      ****   **********          *******   ***              *******   ***           ****      *** ***    ..niche..   ***********              *** ***     ******      ***   ***         ****   *** ***   ***********   ***    *******      *******   ***              ****   ***     *******      *******   ***           ********   *** ***          ****   *** ******| | *******   ***              ****   *** ***     ****    ***   *****                 ****    ****     ******| | |
search RasMol script viewer Motif-ligand binding stats  stmotif ..         ..                                                        ..                                                                                                                                                                                                                    |   |                                                                                                         ..stmotif..                                                                                                                                                    | |                                                                                              | |    | |                                                                                                   *****
search RasMol script viewer Motif-ligand binding stats  ststaple ..         ..                                                        ..                                                                                                                                                                                                                    *****                                                                                                         ..ststaple..                                                                                                                                                    | |                                                                                              | |    | |                                                                                                   | |  
search RasMol script viewer Motif-ligand binding stats  stturn ..         ..                                                        ..                                                                                                                                                                                                                                                                                                                                  ..stturn..                                                                                                                                                    ***                                                                                              ***    ***                                                                                                   ***  

chain B : TOLL-LIKE RECEPTOR 8
member of: GENE3D:searchG3DSA_3.80.10.10PANTHER:searchPTHR24365/searchPTHR24365_SF227PFAM:searchPF13516/searchPF13855PROSITE PROFILES:searchPS51450, SMART:searchSM00082/searchSM00369SUPERFAMILY:searchSSF52047/searchSSF52058UniProt:searchQ9NR97
JMol viewer RasMol script viewer  NAG 916B  ..         ..                                                        ..                                                                                                                                                                                                                                                                                                                                  ..NAG ..                                                                                                                                                     ** *                            *                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 915B  ..         ..                                                        ..                                                                                                                                                                                                                                                              ** *                        *                                       ..NAG ..                                                                                                                                                     || |                            |                                                                                                                                                                                  
JMol viewer RasMol script viewer  BMA 912B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..BMA ..                   *                                                                                                                                 || |                            |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 911B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..NAG ..                 * *                                                       *                       *                                                 || |                            |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 910B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..NAG ..                 * |                                                       |                       | *                           * *                 || |* *                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  MAN 913B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..MAN ..                 | |                                                       |                       | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 909B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..NAG ..                 | |                                           *           |           **          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 908B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..NAG ..                 | |                                           |           |           ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 907B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..NAG ..                 * |*         **                    *          |           * *         ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  BMA 904B  ..         ..                                                        ..                                                                                                                                                                                                                                                              || |                        |                                       ..BMA ..     *           | ||         ||                    |          |           | |         ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 903B  ..         ..                                                        ..                                                                                                                 *                       *                                        *                                                                           || |                        |                                       ..NAG ..     **          | ||         ||                    |          |           | |         ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 902B  ..         ..                                                        ..                                                                                                                 | * *                   | * *                                    * *                                                                         || |                        |                                       ..NAG ..     ||***       | ||         ||                    |          |           | |         ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  MAN 905B  ..         ..                                                        ..                                                                                                                 | | |                   | | |                                    | |                                                                         || |                        |                                       ..MAN ..     *||||       | ||         ||                    |          |           | |         ||          | |                           | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  L07 901B  ..         ..                                                        ..                                                                                                                 | | |                   | | |                                    | |                                                                         || |                        |                                       ..L07 ..     |||||       | ||         ||                    |          |           | |      * *||          | |           ***             | |                 || || |                         |                                                                                                                                                                                  
JMol viewer RasMol script viewer  L07 901A  ..         ..                                                        ..                                                                                                                 | | |                   | | |                                    | |                                                      *    *             || |       *                |         *                             ..L07 ..     |||||       | ||         ||                    |          |           | |      | |||          | |           |||             | |                 || || |                         |                                                                                                                                                                                  
sec str:  ........ee....eee..................eee.......ee............eee...........ee............eee..................eee.......eehhhhhh......eee..............ee...hhhhh....eee..................eee.......ee............eee.................hhhhh..ee............eee.........hhhhhh......eee.....hhhhhhhhhhhhhh....eee................hhhhhhh....eee.......ee.hhhhhhhh......eee.......ee..hhhhhh....eee............. ...................hhhhhh...eee.....................eee......................eee.....................eee...hhhhhh.......hhhhhhh....eee.....................eee....hhhhhh..................eee.........hhhhhhh......eee.........hhhhhhhh....eee...........hhhhhh....eee.....................eee.........hhhhhh........eee.....ee.hhhhhhhhhhhhhh......hhhhh.eee.......hhhhh.
sequence :  ..SRSYPCDEK..VIAECSNRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNV..GLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNLEIIYLSENRISPLV... ..FEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLE
seq num:  ..31       ..45        55        65        75        85        95    ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423         ... ..459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609       619       629       639       649       659       669       679       689       699       709       719       729       739       749       759       769       779       789       799       809       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..** | |   ..*  | |||||   |  ||  ||  | | | |    ^***|  |^*** ||| |   ..| ^***| |  ||||  || |||||     | | || ||| | | | ^***  |  |  |   | || ||| |    |  | | |  || || || |   | |     | ||| || |||||   | |||  | ^*** ||| |  ||| |      |  |    ||  |  ^***|   ^***||||  | |    |  |   | |         ||||  ||  |   | || ||  |     ^***^***| |||     ||||          |  | ^*** | |||||       | ^*** |  | | | |    ..PS00001.. | | ||| ||| |              | | | |     | || |      ^***||| |  ||||  ||  |   | | | || |^***| ||| ||  | || | |  |  |   |  | ^***|   ^***||| ||||| |  | || | | |     |  | ||    | || | ^*** | |||||       |  || || | | | | |   ^***   |  |  || | | | | | |||||| |||  | | | |     | |  | |||  | | | |   ^*** || ||||||  ||| |    | |       |  |  |   |||||   | |||| ||| || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |   ..   | |||||   |  ||  ||  | | | |     |  |  | |   ||| |   ..|     | |  ||||  || |||||     | | || ||| | | |   |   |  |  |   | || ||| |    |  | | |  || || || |   | |     | ||| || |||||   | |||  |  ||  ||| |  ||| |      |  |    ||  |   |  |   | ||||||  | |    |  |   | |         ||||  ||  |   | || ||  |       | ||  | |||     ||||          |  |  |   | |||||       |  ||  |  | | | |    ..PS00004.. | | ||| ||| |              | | | |     | || |      | ||||| |  ||||  ||  |   | | | || || ||| ||| ||  | || | |  |  |   |  |  |  |   | ||||| ||||| |  | || | | |     |  | ||    | || |  ||  | |||||       |  || || | | | | |   | ||   |  |  || | | | | | |||||| |||  | | | |     | |  | |||  | | | |     |  || ||||||  ||| |    | |       |  |  |   |||||   | |||| ||| || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |   ..   | ^**||   |  ||  ||  | | | |     |  |  | |   ||| |   ..|     | |  ||||  || |||||     | | || ||| | | |   |   |  |  |   | || ||| |    |  | | |  || || || |   | |     | ^** || |||||   | |||  |  ||  ||| |  ||| |      |  |    ||  |   |  |   | |||^**  | |    |  |   | |         ||||  ||  |   | || ||  |       | ||  | ^**     ||||          |  |  |   | |||||       |  ||  |  | | | |    ..PS00005.. | | ||| ||| |              | | | |     | || |      | ||||| |  ||||  ||  |   | | | || || ||| ||| ||  | || | |  |  |   |  |  |  |   | ||||| ||^** |  | || | | |     |  | ||    | || |  ||  | |||||       |  || || | | | | |   | ||   |  |  || | | | | | |||||| ^**  | | | |     | |  | ^**  | | | |     |  || |^**||  ||| |    | |       |  |  |   |||||   | |||| ||| || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |   ..   | |||||   |  ||  |^*** | | |     |  |  | |   ||| |   ..|     | |  ||||  || |||||     | | ^***|| | | |   |   |  |  |   | || ||| |    ^*** | |  |^*** || |   | |     |  |  || |||||   ^***|  |  |^***|| |  ||| |      |  |    ||  |   |  |   | |||||   | |    |  |   | |         ||||  ||  |   | || ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |^***  | | | |    ..PS00006..** | ||| ||| |              | | | |     | || |      | ||||| |  ^***  ||  |   | | | || || ||| ||^***  | || | |  |  |   |  |  |  |   | ||||| ^***| |  | ^*** | |     |  | ||    | || |  |^*** |||||       |  || ^*** | | | |   | ||   |  |  || | | | | | ^***|| ||   | | | |     | |  |  |   | | | |     ^***| | | |^***|| |    | |       |  |  |   |||||   ^***|| ||| || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |   ..   | |||||   |  ||  |   | | | |     |  |  | |   ||| |   ..*     ^*****|||  || |||||     ^*****  || | | |   |   |  |  |   | || ||| |         ^*****  |  || |   | |     |  |  || |||||   | | |  |  |   ||| |  ||| |      |  ^*****|  |   |  |   | |||||   | |    |  |   | |         |^*****|  |   | || ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..PS00008..   | ||| ||| |              | | | |     | || |      | ||||| |  |^*****|  |   | | | || || ||| ||  |   | || | |  |  |   |  |  |  |   | |||||  || | |  | ||   | |     |  | ||    | || |  |   | |||||       |  ||  |   | | | |   | ||   |  |  || | | | | | |||||| ||   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   |||||     | || ||| || 
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..   | |   ..   | |||||   |  ||  |   | | | |     |  |  | |   ||| |   ..      | |  ||||  **********************| | | |   |   |  |  |   | || ||| |         | |  |  |  **********************| |||||   | | |  |  |   ||| |  ||| |      |  |     |  |   |  |   | |||||   | |    |  |   | |         ||||   |  |   | || ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..PS00029..   | ||| ||| |              | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ||| ||  |   | || | |  |  |   |  |  |  |   | |||||  || | |  | ||   | |     |  | ||    | || |  |   | |||||       |  **********************   |  |  **********************   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   |||||     | || ||| || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |   ..   | |||||   |  ||  |   | | | |     |  |  | |   ||| |   ..      | |  ||||   | |||||       |  |   | | | |   |   |  |  |   | || ||| |         | |  |  |   | |   | |     |  |   | |||||   | | |  |  |   ||| |  ||| |      |  |     |  |   |  |   | |||||   | |    |  |   | |         ||||   |  |   | || ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..alphabetamotif..   | ||| ||| |              | | | |     | || |      | ||||| |  ||||   |  |   | | | || || ||| ||  |   | || | |  |  |   |  |  |  |   | |||||  || | |  | ||   | |     |  | ||    | || |  |   | |||||       |  ||  |   | | | |   | |    |  |   | | | | | | |***** ||   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   *****     | || ||| || 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |   ..   | |||||   |  ||  |   *** | |     |  |  | |   *** |   ..      | |  ||||   | |||||       |  |   | | | |   |   |  |  |   | || ||| |         | |  |  |   | |   | |     |  |   | |||||   | | |  |  |   ||| |  ||| |      |  |     |  |   |  |   ***||||   ***    |  |   | |         ||||   |  |   ***| ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..asxturn..   ***|***|| |              *** | |     | || |      ***|||***  ||||   |  |   *** | || |***|| ||  |   | || | |  |  |   |  |  |  |   ***||||  || | |  | ||   | |     |  ***|    | || |  |   ***||||       |  ||  |   | | | |   ***    |  |   | | | | | | |||||| ||   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   |||||     | || ||| || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |   ..   | |||||   |  ||  |   | | | |     ****  | |   |****   ..      | |  ||||   | |||||       |  |   | | | |   |   *******   | || |****         | |  |  |   | |   | |     |  |   | |||||   | | |  |  |   |****  ||| |      ****     ****   ****   | |||||          |  |   | |         ||||   |  |   | || |****       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..betaturn..   |  ||  || |              | | | |     | || |      | ||||| |  ||||   |  |   | | | || ||  || ||  |   | || | ****  |   ****  |  |   | |||||  || | |  | ||   | |     ****  |    **** |  |   | |||||       |  ||  |   | | | |          |  |   | | | | | | *****| ||   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   *****     | ********| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |   ..   | |||||   |  ||  |   | | | |           | |   | |     ..      | |  ||||   | |||||       |  |   | | | |   |   |  |  |   | || | | |         | |  |  |   | |   | |     |  |   | |||||   | | |  |  |   ||| |  ||| |                      |  |   | |||||          |  |   | |         ||||   |  |   | || ||  |       | ||  |  |      ||||          |  |  |   | |||||       |  |      | | | |    ..gammaturn..   |  ||  || |              | | | |     | || |      | ||||| |  ||||   |  |   | | | |***|  || ||  |   | || | |  |  |      |  |  |   | |||||  |*** |  | ||   | |     |  |  |      |  |  |   | |||||       |  ||  |   | | | |          |  |   | | | | | | | |  | ||   | | | |     | |  |  |   | | | |     |  || | | |   ||| |    | |       |  |  |   ||| |     | || | |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..   | |   ..   | |****   |  ||  |   | | | |           | |   | |     ..      ***  ****   | |****       |  |   | | | |   |   |  |  |   | |*** | |         ***  |  |   | |   ***     |  |   | |****   | | |  |  |   ||| |  ||| |                      |  |   | |****          |  |   | |         ****   |  |   | |***|  |       | ||  |  |      ****          |  |  |   | |****       |  |      | | | |    ..nest..   |  ||  || |              | | | |     | || |      | |**** |  ****   |  |   | | | |   |  |***|  |   | |*** |  |  |      |  |  |   | |****  |  | |  | ||   | |     |  |  |      |  |  |   | |****       |  ||  |   | | | |          |  |   | | | | | | | |  | ||   | | | |     ***  |  |   | | | |     |  |*** | |   ||| |    | |       |  |  |   *** |     | || | |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..   ***   ..   ***       ********   *** ***           ***   ***     ..            ***   ***           ****   *** ***   |   |  ****   ***    ***           *******   ***           ****   ***       | | *******   *****  *****                      ****   ***              ****   ***                ****   **********       | |*******                    *******   ***           ****      *** ***    ..niche..   ***********              *** ***     ******      ***   ***         ****   *** ***   ***********   ***    *******      *******   ***      ******  ****   ***     *******      *******   ***           ********   *** ***          ****   *** ***** | | *******   *** ***       *******   *** ***     ****    ***   *****    | |       *******    ****     ****** **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..         ..                                                        ..                                                 *****                                                                       | |                                                                                                                       | |                                                                        ..stmotif..                                                                                                                                                    | |                                                                                              | |    | |                                                               | |                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..         ..                                                        ..                                                                                                                             ***                                                                                                                       ***                                                                        ..stturn..                                                                                                                                                    ***                                                                                              ***    ***                                                               ***                                       

   New search    3w3k:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors