triangle PDBeMotif: 3vsq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transport protein    | release date: Wed, May 2, 2012
Title crystal structure of the cytoplasmic domain of g-protein-gat rectifier potassium channel kir3.2 e236r mutant in the pres ethanol
Authors A.INANOBE, Y.KURACHI
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search BME BME binding statistics BME
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GSHMRKIQRYVRKDGKCNVHHGNVREKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGE
FIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEIL
WGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRAEL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : G PROTEIN-ACTIVATED INWARD RECTIFIER POTASSIUM CH
member of: GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF19PFAM:searchPF01007PIRSF:searchPIRSF005465PRINTS:searchKIR32CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchP48542
JMol viewer RasMol script viewer  MG 403A  ..                 ..                                                                                                                                                                                    
JMol viewer RasMol script viewer  BME 402A  ..                 ..      *                           *                                                                                      ***                                                        
JMol viewer RasMol script viewer  BME 401A  ..       ***       ..      |                          *|                                         *                                            |||*                                                       
sec str:  .............eeee.....hhhhh.....eeeeee..eeeeeeee.......eeeeeeeeeeeeeee.....eeeeeeeee.........ee.....eeeeee.............hhhhh..eeeeeeeeee.....eeeeeeeee...eee.eee...eeee..eeeee.hhh..eee......hhhhhhhhhhh.
sequence :  ..QRYVRKDGKCNVHHGNV..KRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVRASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANRA
seq num:  ..56        66     ..200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |||        ..              | || |         |  | |  || |        ||||| |  ^*** ||||||||||             |  | |  ||   |  |         |    | |         |  ||  |   | ||  |     | ||  |      | || |||  |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |||        ..              ^**| |         |  | |  |^**        ||||| |  |    ||||||||||             |  | |  ||   |  |         |    | |         |  ||  |   | ||  |     | ||  |      | |^**||  |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |||        ..              ^*** |         |  | |  |           |^*** |  |    |||||^***|             |  | |  ||   |  |         |    | |         |  ||  |   | |^***     | |^***      | |^***|  |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |||        ..                |  |         |  | |  |           | ||| |  |    ||||||||||             |  | |  ||   |  |         ^***** |         |  ||  |   | |         | ||  |      | ||   |  |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |||        ..                |  |         |  | |  |           | ||| |  |    ***|||||||             |  | |  ||   |  |              | |         |  ||  |   | |         ***|  |      | ||   |  |  | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    *****        ..                |  |         |  | |  |           ***** |  |     |||||||||             |  | |  ||   |  |              | |         |  ||  |   | |            |  |      | ||   |  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ****|        ..                ****         |  | |  |           ****| |  |     |||||||||             **** |  ||   ****              | |         |  ||  |   | |            |  |      | ||   |  |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..      ***        ..                             |  | |  |             *** |  |     ********|             |  | |  ||   |  |              ***         |  ||  |   | |            |  |      | ||   |  |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                 ..                             **** ****                 ****          ****             **** ****|   ****                          ********   ***            ****      ***|   |  **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 ..                                                                                         | |   *****                                                                    *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                 ..                                                                                         ***                                                                                        

   New search    3vsq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors