triangle PDBeMotif: 3vpm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.17.4.1
Classification oxidoreductase    | release date: Mon, Mar 5, 2012
Title crystal structure of human ribonucleotide reductase subunit mutant
Authors B.CHEN, C.YANG, H.LIU, J.SHAO, L.ZHANG, L.ZHU, W.ZHU, X.CHEN, Z.XU
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNEN
LVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGER
VVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFL
TEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
member of: CATH:search1.10.620.20GENE3D:searchG3DSA_1.10.620.20PANTHER:searchPTHR23409/searchPTHR23409_SF20PFAM:searchPF00268PROSITE PATTERNS:searchPS00368, SUPERFAMILY:searchSSF47240UniProt:searchP31350
JMol viewer RasMol script viewer  FE 402A  ..                                                                                                        *                                                              *                                 *                                                                                    
JMol viewer RasMol script viewer  MG 401A  ..             *  *                                                                          *            |                                                              |                                 |                                                                                    
sec str:  ........................hhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhhhhhhhhhh...............
sequence :  ..MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
seq num:  ..65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  ||  |   |  |              ||| ||  |  |        | |||  ||   |                |    |  | |            ||  |   |    |  | | |      | | |||  |        |  | |||  ||        |    |       || |||   |   |   |  |         || ||    |   |           |   |    || |||^***|              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  ||  |   |  |              ||| ||  |  |        | ^**  ||   |                |    |  | |            ||  |   |    |  | | |      | | |||  |        |  | |||  ||        |    |       || |||   |   |   |  |         || ||    |   |           |   |    || ||||  ||              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  ||  |   |  |              ||| ||  |  |        |  ||  ||   |                |    |  | |            ||  |   |    |  | | |      | | |||  |        |  | ||^***|        |    |       || |||   |   |   ^***         || ||    |   |           |   |    || ||||  ||              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  ||  |   |  |              ||| ||  |  |        |  ||  ||   |                |    |  | |            ||  |   |    |  | | |      | | |||  |        |  | |||   |        ^*****       || |^*****   |   |            || ||    |   |           |   |    || |^*****|              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  RIBORED_SMALL ..  |  ||  |   |  |              ||| ||  |  |        |  ||  ||   |                |    |  | |            *^**^***^******** | |      | | |||  |        |  | |||   |                     || |||       |   |            || ||    |   |           |   |    || ||||   |              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  ||  |   |  |              ||| ||  |  |        |  |*****   |                |    |  | |                         |  | | |      | | |||  |        |  | |||   |                     || |||       |   |            || ||    |   |           |   |    || ||||   |              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  ||  |   |  |              ||| ||  |  |        |  ||  ||   |                |    |  | |                         |  | | |      | | |||  |        |  | |||   |                     || |||       |   |            || ||    |   |           |   |    || |||*****              | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  ||  |   |  |              ||| ||  |  |        |  ||  ||   |                |    |  | |                         |  | ***      | | |||  |        |  ***||   |                     || |||       |   |            || ||    |   |           |   |    || |||                   | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  ||  |   |  |              |****|  |  |        |  |****|   |                |    |  | |                         |  | |        | | ||****        |  |  ||   |                     |****|       |   |            ****|    |   |           |   |    |****|                   | |   | | | |   
search RasMol script viewer Motif-ligand binding stats  nest ..  |  ||  |   |  |              | | ||  |  |        |  |    |   |                |    |  | |                         |  | |        | | ||            |  |  ||   |                     |  ***       |   |             |  |    |   |           |   |    |  ***                   ***   *** | |   
search RasMol script viewer Motif-ligand binding stats  niche ..  ********   ****              | ****  ****        ****    |   |                |    ******                         ******        | ****            *******|   |                     |    |       |   |             ****    |   |           |   |    |    |                             ***   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               |   |                       |   |                |    |                                            |   |                    |   |                     ******       |   |                     |   |           |   |    ******                                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                       |   |                |    |                                            |   |                    *****                                  |   |                     *****           |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                       *****                ******                                            *****                                                           *****                                     *****                                             

chain B : RIBONUCLEOSIDE-DIPHOSPHATE REDUCTASE SUBUNIT M2
member of: CATH:search1.10.620.20GENE3D:searchG3DSA_1.10.620.20PANTHER:searchPTHR23409/searchPTHR23409_SF20PFAM:searchPF00268PROSITE PATTERNS:searchPS00368, SUPERFAMILY:searchSSF47240UniProt:searchP31350
JMol viewer RasMol script viewer  FE 402B  ..                                                                                                        *                                                              *                                 *                                                                                    
JMol viewer RasMol script viewer  MG 401B  ..                                                                                                        |                                                              |                                 |                                                                                    
sec str:  ........................hhhhhhhhhhhhhh..hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhhhhhhhhhh...............
sequence :  ..MGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEAVDLSKDIQHWESLKPEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFM
seq num:  ..65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  ||  | | |  |   | |        | | ||  |  |        | |||            |   |       |    |  | |            ||  |   |    |  | |          |  |            |  | |||  ||        ||  ||   |   || |||   |   |   |  |          |  |    |   |           |   |    || |||^***|           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  ||  | | |  |   | |        | | ||  |  |        | ^**            |   |       |    |  | |            ||  |   |    |  | |          |  |            |  | |||  ||        ||  ||   |   || |||   |   |   |  |          |  |    |   |           |   |    || ||||  ||           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  ||  | | |  |   | |        | | ||  |  |        |  |             |   |       |    |  | |            ||  |   |    |  | |          |  |            |  | ||^***|        ||  ||   |   || |||   |   |   ^***          |  |    |   |           |   |    || ||||  ||           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  ||  | | |  |   | |        | | ||  |  |        |  |             |   |       |    |  | |            ||  |   |    |  | |          |  |            |  | |||   |        ^*****   |   || |^*****   |   |             |  |    |   |           |   |    || |^*****|           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  RIBORED_SMALL ..  |  ||  | | |  |   | |        | | ||  |  |        |  |             |   |       |    |  | |            *^**^***^******** |          |  |            |  | |||   |         |  ||   |   || |||       |   |             |  |    |   |           |   |    || ||||   |           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  ||  | | |  |   | |        | | ||  |  |        |  |             |   |       |    |  | |                         |  | |          |  |            |  | |||   |         |  ||   |   || |||       |   |             |  |    |   |           |   |    || |||*****           || |||   | | | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  ||  | ***  |   | |        | | ||  |  |        |  |             |   |       |    |  | |                         |  | |          |  |            |  ***||   |         |  ||   |   || |||       |   |             |  |    |   |           |   |    || |||                || |||   | | ***   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  ||  |   ****   | |        | | ||  |  |        |  |             |   |       |    |  | |                         |  | |          |  |            |  |  ||   |         ****|   |   |****|       |   |             ****    |   |           |   |    *****|                |****|   | |       
search RasMol script viewer Motif-ligand binding stats  nest ..  |  ||  |   |  |   | |        | | ||  |  |        |  |             |   |       |    |  | |                         |  | |          |  |            |  |  ||   |             |   |   |  ***       |   |             |  |    |   |           |   |       ***                |  ***   ***       
search RasMol script viewer Motif-ligand binding stats  niche ..  ********   ****   ***        | ****  ****        ****             |   |       |    ******                         ******          ****            *******|   |             |   |   |    |       |   |             ****    |   |           |   |                          |    |             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               |   |                                |   |       |    |                                                                     |   |             |   |   ******       |   |                     |   |           |   |                          ******             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               |   |                                |   |       |    |                                                                     *****             |   |                |   |                     *****           |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                               *****                                *****       ******                                                                                       *****                *****                                     *****                                             

   New search    3vpm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors