triangle PDBeMotif: 3voq  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein    | release date: Tue, Jan 31, 2012
Title crystal structure of the pleckstrin homology domain of human torc2 subunit
Authors D.PAN, Y.MATSUURA
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSP
SHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TARGET OF RAPAMYCIN COMPLEX 2 SUBUNIT MAPKAP1
member of: PANTHER:searchPTHR13335PFAM:searchPF05422UniProt:searchQ9BPZ7
sec str:  ..hhhhhhhhhhh....eeeeeeeee...eeeeeeeee...eeeeee............eeee...eeeeeeeee.....eeeeeeeee..eeeeeeeeehhhhhhhhhhhhhhhhhh..
sequence :  ..GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPV..TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA
seq num:  ..369       379       389       399       409   ..421       431       441       451       461       471       481       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   || |  |  |  ^**      | |        | |       ..** |        |||||     ||  | ||        |  |        | ||| |        |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   ^***  |  |           | |        | |       ..|  |        |||||     ||  | ||        ^***        | |^***        |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****    |  |           | |        | |       ..|  |        |||||     ||  | ||                    | | |          |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          |  |           | |        | |       ..|  |        *****     ||  | ||                    *****          |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |           | |        | |       ..|  |        ***||     ||  | ||                    ***            |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |           | |        | |       ..|  |        || ||     **  | ||                                   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |           | |        | |       ..|  |        ****|         | ||                                   |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..          |  |           ***        | |       ..|  |         |  |         | ||                                   |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..          ****                      | |       ..****         ****         ****                                   **** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    ***       ..                          ***                                         

chain B : TARGET OF RAPAMYCIN COMPLEX 2 SUBUNIT MAPKAP1
member of: PANTHER:searchPTHR13335PFAM:searchPF05422UniProt:searchQ9BPZ7
sec str:  ...hhhhhhhhhhhhh.eeeeeeeeee..eeeeeeeee...eeeeee........eeee...eeeeeeeeeee..eeeeeeeeee..eeeeeeeeehhhhhhhhhhhhhhhhhh...
sequence :  ..GAMATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPV..IKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRAS
seq num:  ..369       379       389       399       409   ..425       435       445       455       465       475       485    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   || |  |  |  ^**     |  |        |  |      .. | |    || ||||   ||  | |||       |  |        | ||  |         |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   ^***  |  |          |  |        |  |      .. | |    || ||||   ||  | |||       ^***        | |^***         |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****    |  |          |  |        |  |      .. | |    || ||||   ||  | |||                   | |             |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..          |  |          |  |        |  |      .. | |    || ||||   ||  | |||                   ***             |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..          |  |          |  |        |  |      .. | |    || ||**   **  | |||                                   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |  |          ****        |  |      .. | |    ****|         ****|                                   |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..          ****          ****        ****      .. ***     ****         ****|                                   **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              ..                      *****                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                              ..                      ***                                          

   New search    3voq:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors