triangle PDBeMotif: 3v4r  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.21.5
Classification hydrolase/dna    | release date: Thu, Dec 15, 2011
Title crystal structure of a uvrb dimer-dna complex
Authors M.P.J.WEBSTER, R.JUKES, T.BARRETT
Method X-RAY DIFFRACTION (resolution: 3.25Å)
PDBe Citation   
Small molecules:    search ADP ADP binding statistics ADP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
HHHHHHMKDRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLY
SEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEY
REMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEI
LGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLT
LRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSA
TPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNY
LHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYAD
KITKSMEIAINETKRRREQQERFNEEHGITPKTINKEIRDVIRATVAAEDKAEYKTKAAPKLSKMTKKERQKVVEQMEHE
MKEAAKALDFERAAELRDLLLELKAEG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UVRABC SYSTEM PROTEIN B
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.30.2060.10/searchG3DSA_3.40.50.300/searchG3DSA_4.10.860.10HAMAP:searchMF_00204PANTHER:searchPTHR24029/searchPTHR24029_SF0PFAM:searchPF00271/searchPF02151/searchPF04851/searchPF12344PROSITE PROFILES:searchPS50151/searchPS51192/searchPS51194, SMART:searchSM00487/searchSM00490SUPERFAMILY:searchSSF46600/searchSSF52540TIGRFAMS:searchTIGR00631UniProt:searchP37954
JMol viewer RasMol script viewer  ADP 701A  ..        **    *                        * ****                            *                                                                                                                                ..ADP ..                                                                                                                                                                                                                                                                                                                                                *                                               
sec str:  ...............hhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhh...eeeee...eeeee..eee....eee..eeeehhhhhhhhhhhhhhhhhh..eeeee.hhhhh...hhhhhhhh.eeee.....hhhhhhhhhhh...ee........eeee...eeeee.... .....eeeeeee....eeeeeeee.......eee.eeee...........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.........hhhhhh....eeeeehhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh...hhhhhhh...eeeeee...hhhhhhhh...eee..........eeeee...hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhh..eee.......hhhhhhhhhhhhh...eee.............eeeeeee.....hhhhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhhhhhhhhhhhhh.........
sequence :  ..DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFP... ..RDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPASHFVTRAEKMEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTINK
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193         ... ..207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |  |  |         |  | ||     |  |||||   |     | |       ^*** |   ||    |  |      | ||       |  | |  |   | |||    ||  ||            ||||||   |  | |  | | || ||       |    | |       |  | | | |      ..PS00001.. |||           ||       | | |         | |   |  |                   || |||      |   |  |      | | ||||^***  | ||  |   | || |        || |||     |    |      || ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||     | |||||   | |   |||   | | | | |          ||||      | || | ||  |      | || || || |||  |   |  |  |         |   |   ^***|           | || |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  |||||   |     | |       | |  |   ||    |  |      | ||       |  | |  |   | |||    ||  ||            ||||||   |  | |  | | || ||       |    | |       |  | | | |      ..PS00004.. |||           ||       | | |         | |   |  |                   || |||      |   |  |      | | |||| |    | ||  |   | || |        || |||     |    |      || ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||     | |**^*   | |   |||   | | | | |          ||||      | || | ||  |      | || || || |||  |   |  |  |         |   |     | |           | || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  |^**|   |     | |       | |  |   ||    |  |      | ||       |  | |  |   | |||    ||  ||            ||||||   |  | |  | ^**| ||       |    | |       |  ^** | |      ..PS00005.. |||           ||       | | |         | |   |  |                   || |||      |   |  |      | | |||| |    ^**|  |   | || |        || |||     |    |      || ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||     | ^** |   | |   |||   | | | | |          ||||      | || | ||  |      | || || |^**||  |   |  |  |         |   |     ^**           | |^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  |||||   |     | |       | |  |   ||    |  |      ^***       |  | ^***   ^***|    ||  ||            ||||||   ^*** |  |   |^***       |    | |       |  |   | |      ..PS00006..***|           ||       | | |         | |   ^***                   || |||      |   ^***      | | ^*** |    | ||  |   ^*** |        || |||     |    |      || ||||  ^***|        |  |             ||  |     | |  | |        | || |          | |||     | | | |   | |   |||   | | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  |||||   |     | |       | |  |   ||    |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |        *******^       |  |   | |      ..PS00007.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||     |    |      || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | | ********^   |||   | | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |  |  |         ^*****|     ^*****||   |     | |       | |  ^*****    |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |             | |       |  |   | |      ..PS00008.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||     ^*****      || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     |^***** | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      | |  |  |            ^***     |  |||||   |     | |       | |  |   |     |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |             | |       |  |   | |      ..PS00009.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  RGD ..      | |  |  |            | |      |  |||||   |     | |       | |  |   |     |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |             | |       |  |   ***      ..PS00016.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      | |  |  |            | |      ********   |     | |       | |  |   |     |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |             | |       |  |            ..PS00017.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  |  |            | |         |||||   |     | |       | |  |   |     |  |      | |        |  | |        | |    ||  ||            ||||||        |  |   |  |             | |       |  |            ..alphabetamotif.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        |*****                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |  |  |            | |         |||||   |     | |       ***  |   |     |  |      | |        |  | |        ***    ||  ||            ||||||        |  |   |  |             | |       |  |            ..asxturn.. | |           ||       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |  |  |            | |         |||||   |     | |            |   |     |  |      | |        |  | |               ||  ||            ||||||        |  |   |  |             | |       |  |            ..betabulge.. | |           **       | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |  |  |            | |         |||||   |     | |            |   |     |  |      | |        ******               ||  ||            ||||||        |  |   |  |             | |       |  |            ..betabulgeloop.. | |                    | | |         | |                          || |||      |   |         | |  ||| |    | ||  |   | || |        || |||                 || ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || || ||  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  ****            | |         |||||   |     | |            |   |     |  |      | |           | |               ||  ||            *****|        |  |   |  |             | |       ****            ..betaturn.. | |                    | | |         | |                          |****|      |   |         | |  |****    | ||  |   **** |        |****|                 |****||   |  |        |  |             ||  |     | |  | |        | || |          ****|     | |   |   |     | |     | | | |          ||||      | || | ||  |      | || ****|  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |                  | |         |||||   |     | |            |   |     |  |      | |           | |               ||  ||            | | ||        |  |   |  |             | |       |  |            ..gammaturn.. ***                    | ***         | |                          |  | |      |   |         | |  | |      | ||  |     |  |        || | |                 |  ||||   |  |        |  |             ||  |     | |  | |        | || |            | |     | |   |   |     | |     | | ***          ||||      | || | ||  |      | ||  |  |  ||  |   |  |  |         |   |                   | |       
search RasMol script viewer Motif-ligand binding stats  nest ..      | |                  ***         *****   |     ***            |   |     |  |      | |           ***               ||  ||            | | ||        |  |   |  |             ***       |  |            ..nest..                        ***           | |                          |  ***      |   |         ***  ***      ***|  |     |  |        |*** |                 |  ****   |  |        |  |             ||  |     | |  ***        | |***            ***     | |   |   |     ***     | |              ****      ***| ***|  |      ***|  |  |  ||  |   |  |  |         |   |                   ***       
search RasMol script viewer Motif-ligand binding stats  niche ..      ***                                  |   |                    |   |     ****      ***                             ||  ||            | ****        ****   ****                       ****            ..niche..                                      ***                          |    |      |   |                          ****     ****        |    |                 |    |    ****        ****             |****     ***             ***                       ***   |   |             ***                        ****    ****      ****  ****  ||  |   *******         |   |                             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..      | |                                  |   |                    |   |               | |                             ||  ||            | | |                                                           ..schellmannloop..                                                                   ******      |   |                                               |    |                 ******                                 |   |                                                     |   |                                                                   |  ||  |                   |   |                             
search RasMol script viewer Motif-ligand binding stats  stmotif ..      | |                                  |   |                    |   |               | |                             ||  ||            *****                                                           ..stmotif..                                                                               |   |                                               |    |                                                        |   |                                                     |   |                                                                   *****  |                   *****                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..      | |                                  *****                    *****               | |                             ******            | |                                                             ..ststaple..                                                                               *****                                               ******                                                        *****                                                     *****                                                                      *****                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..      ***                                                                               ***                                               ***                                                             ..stturn..                                                                                                                                                                                                                                                                                                                                                                                                

chain B : UVRABC SYSTEM PROTEIN B
member of: CATH:search3.40.50.300GENE3D:searchG3DSA_3.30.2060.10/searchG3DSA_3.40.50.300/searchG3DSA_4.10.860.10HAMAP:searchMF_00204PANTHER:searchPTHR24029/searchPTHR24029_SF0PFAM:searchPF00271/searchPF02151/searchPF04851/searchPF12344PROSITE PROFILES:searchPS50151/searchPS51192/searchPS51194, SMART:searchSM00487/searchSM00490SUPERFAMILY:searchSSF46600/searchSSF52540TIGRFAMS:searchTIGR00631UniProt:searchP37954
JMol viewer RasMol script viewer  ADP 701B  ..                                       * ***                                                                                                                                                                                                         ..ADP ..                                                                                                                                                                                                                                                                                                                                              
sec str:  ...............hhhhhhhhhhhhhhh....eeeee....hhhhhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhh...eeeee...eeeee..eee....eee..eeeehhhhhhhhhhhhhhhhhh..eeeee.hhhhh...hhhhhhhhheeee.....hhhhhhhhhhhh..ee........ee.....eeee.......eeeeeeee..eeeeeeeee.......eee.eeee....... ...hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.........hhhhhh....eeeeehhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh...hhhhhhh...eeeeee...hhhhhhhh...eee..........eeeee...hhhhhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhhhh..eee.....hhhhhhhhhhhhhhh...eeee............eeeeeee.....hhhhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhhhhhhhhhhhhhhhhh........
sequence :  ..DRFELVSKYQPQGDQPKAIEKLVKGIQEGKKHQTLLGATGTGKTFTVSNLIKEVNKPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYYDYYQPEAYVPQTDTFIEKDASINDEIDKLRHSATSALFERRDVIIIASVSCIYGLGSPEEYREMVVSLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRVRGDVVEIFPASRDEHCVRVEFFGDEIERIREVDALTGEILGDRDHVAIFPAS... ..MEKAIQNIEKELEEQLKVMHENGKLLEAQRLEQRTRYDLEMMREMGFCSGIENYSRHLTLRPPGSTPYTLLDYFPDDFMIVVDESHVTIPQVRGMFNGDQARKQVLVDHGFRLPSALDNRPLRFEEFEKHMHNIVYVSATPGPYEIEHTDEMVEQIIRPTGLLDPLIDVRPIEGQIDDLIGEIQARIERNERVLVTTLTKKMSEDLTDYLKEIGIKVNYLHSEIKTLERIEIIRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNAEGRVIMYADKITKSMEIAINETKRRREQQERFNEEHGITPKTIN
seq num:  ..3         13        23        33        43        53        63        73        83        93        103       113       123       133       143       153       163       173       183       193       203       213       223       233       243  ... ..256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |  |  |         |  | ||     |  ||||| |       | |       ^*** |   ||    |  |      | |||      |  | |  |   | |||    ||  ||            ||||||   | || |  | | ||| |       |    | |       |  | | | |       |||||           ||    |  | |              ..PS00001..                  || |||      |   |  |      | | ||||^***  | ||  |   ||||||        || |||     |    |         ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||       |||||   | |   |||   | | |              ||||      |  | | ||  |      | |   |  | ||   |   |  |  |         |   |   ^***|           | || |   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  ||||| |       | |            |   ||    |  |      | |||      |  | |  |   | |||    ||  ||            ||||||   | || |  | | ||| |       |    | |       |  | | | |       |||||           ||    |  | |              ..PS00004..                  || |||      |   |  |      | | |||| |    | ||  |   ||||||        || |||     |    |         ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||       |**^*   | |   |||   | | |              ||||      |  | | ||  |      | |   |  | ||   |   |  |  |         |   |     | |           | || |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  |^**| |       | |            |   ||    |  |      | |||      |  | |  |   | |||    ||  ||            ||||||   | || |  | ^**|| |       |    | |       |  ^** | |       |||||           ||    |  | |              ..PS00005..                  || |||      |   |  |      | | |||| |    ^**|  |   ||||||        || |||     |    |         ||||  || ||        |  |             ||  |     | |  | |        | || |          | |||       ^** |   | |   |||   | | |              ||||      |  | | ||  |      | |   |  ^**|   |   |  |  |         |   |     ^**           | |^**   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  ||||| |       | |            |   ||    |  |      ^***|      |  | ^***   ^***|    ||  ||            ||||||   ^*** |  |    ^***       |    | |       |  |   | |       ^***|           ||    |  | |              ..PS00006..                  || |||      |   ^***      | | ^*** |    | ||  |   ^***||        || |||     |    |         ||||  ^***|        |  |             ||  |     | |  | |        | || |          | |||         | |   | |   |||   | | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |  |  |         |  | ||     |  ||||| |       | |            |   ||    |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |       *******^       |  |   | |        ||||           ||    |  | |              ..PS00007..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||     |    |         ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||         ********^   |||   | | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |  |  |         ^*****|     ^*****|| |       | |            ^*****    |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |            | |       |  |   | |        ||||           ||    |  | |              ..PS00008..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||     ^*****         ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     |^***** | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      | |  |  |            ^***     |  ||||| |       | |            |   |     |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |            | |       |  |   | |        ||||           ||    |  | |              ..PS00009..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  RGD ..      | |  |  |            | |      |  ||||| |       | |            |   |     |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |            | |       |  |   ***        ||||           ||    |  | |              ..PS00016..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      | |  |  |            | |      ******** |       | |            |   |     |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |            | |       |  |              ||||           ||    |  | |              ..PS00017..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |  |  |            | |         ||||| |       | |            |   |     |  |      | |||      |  | |        | |    ||  ||            ||||||   | |  |  |     | |            | |       |  |              ||||           ||    |  | |              ..alphabetamotif..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        |*****                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |  |  |            | |         ||||| |       | |            |   |     |  |      | |||      |  | |        ***    ||  ||            ||||||   | |  |  |     | |            | |       |  |              ||||           ||    |  | |              ..asxturn..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |  |  |            | |         ||||| |       | |            |   |     |  |      | |**      |  | |               ||  ||            ||||||   | |  |  |     | |            | |       |  |              ||||           **    |  | |              ..betabulge..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |  |  |            | |         ||||| |       | |            |   |     |  |      | |        ******               ||  ||            ||||||   | |  |  |     | |            | |       |  |              ||||                 ******              ..betabulgeloop..                  || |||      |   |         | |  ||| |    | ||  |   ||||||        || |||                    ||||   |  |        |  |             ||  |     | |  | |        | || |          | |||           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  ****            | |         ||||| |       | |            |   |     |  |      | |           | |               ||  ||            *****|   | |  |  |     | |            | |       ****              ||||                    | |              ..betaturn..                  |****|      |   |         | |  |****    | ||  |   *****|        |****|                    ||||   |  |        |  |             ||  |     | |  | |        | || |          ****|           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      | |                  | |         ||||| |       | |            |   |     |  |      | |           | |               ||  ||            | | ||   | |  |  |     ***            | |       |  |              ||||                    | |              ..gammaturn..                  |  | |      |   |         | |  | |      | ||  |     |  |        || | |                    ||||   |  |        |  |             ||  |     | |  | |        | || |            | |           |   |     | |     | |              ||||      |  | | ||  |      | |   |  |  |   |   |  |  |         |   |                   | |      
search RasMol script viewer Motif-ligand binding stats  nest ..      | |                  ***         ***** |       ***            |   |     |  |      | |           ***               ||  ||            | | ||   | |  |  |                    | |       |  |              ****                    ***              ..nest..                  |  ***      |   |         ***  ***      ***|  |     |  |        |*** |                    ****   |  |        |  |             ||  |     | |  ***        | |***            ***           |   |     ***     | |              ****      |  | ***|  |      ***   |  |  |   |   |  |  |         |   |                   ***      
search RasMol script viewer Motif-ligand binding stats  niche ..      ***                                |   |                      |   |     ****      ***                             ||  ||            | ****   | |  ****                    ***       ****                                                       ..niche..                  |    |      |   |                          ****     ****        |    |                           ****        ****             |****     ***             ***                             |   |             ***                        **** *******            ****  |   |   *******         |   |                            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                         |   |                      |   |                                               ||  ||            | | |    | |                                                                                               ..schellmannloop..                  ******      |   |                                               |    |                                                        |   |                                                     |   |                                                                      |   |                   |   |                            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                         |   |                      |   |                                               ||  ||            *****    | |                                                                                               ..stmotif..                              |   |                                               |    |                                                        |   |                                                     |   |                                                                      |   |                   *****                            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                         *****                      *****                                               ******            | |      | |                                                                                               ..ststaple..                              *****                                               ******                                                        *****                                                     *****                                                                      *****                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                          ***      ***                                                                                               ..stturn..                                                                                                                                                                                                                                                                                                                                              

chain C : DNA: 5 -TACTGTTT-3
sec str:  .........
sequence :  ..ACTGTTT
seq num:  ..2      

chain D : DNA: 5 -TACTGTTT-3
sec str:  .........
sequence :  ..ACTGTTT
seq num:  ..2      

   New search    3v4r:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors