triangle PDBeMotif: 3v3e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Tue, Dec 13, 2011
Title crystal structure of the human nur77 ligand-binding domain
Authors C.SHI, K.YANG, Q.WU, Q.ZHANG, T.LIN, Y.CHEN, Y.ZHAN
Method X-RAY DIFFRACTION (resolution: 2.06Å)
PDBe Citation   
Small molecules:    search GOL GOL binding statistics GOL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains B,A sequence:
MSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAE
LSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSAL
VLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIID
KIFMDTLPFLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  GOL 301B  ..           *  **                                                                         *   *                                                                                             ..GOL ..                                                  
sec str:  ...hhhhhhhhhhhhhh..hhhhh................hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh...... ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh..
sequence :  ..PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQ... ..ASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210    ... ..218       228       238       248       258       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   |     || || |^**|||| |           | |         |  |      |  | ||| ||  ||               |     | |||  | |||  || |||              |   || |    |   | |  |^**  |                             ..PS00005..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |   |     || || || ||||| |           | |         |  |      |  | ||| |^***|               |     | |||  | |||  || |||              |   || |    |   | |  |  |  |                             ..PS00006..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. |   |     || || || ||||| |           | |         |  |      |  | ||| **********************     | |||  | |||  || |||              |   || |    |   | |  |  |  |                             ..PS00029..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |     || || || ||||| |           | |         |  |      |  | ||| ||   |                     | |||  | |||  |*****              |   || |    |   | |  |  |  |                             ..alphabetamotif..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  asxturn .. |   |     || || || ||*** |           ***         |  |      |  | ||| ||   |                     | |||  | |||  || ||               |   || |    |   | |  |  |  |                             ..asxturn..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |   |     || || || || |  |                       |  |      |  | ||| ||   |                     | |||  *****  || ||               |   || |    |   | |  |  |  |                             ..betabulgeloop..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |     ****| ****| |  |                       ****      **** ||| ||   |                     ****|  ****|  *****               |   || |    |   | |  |  |  |                             ..betaturn..      *****                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  nest .. |   |      |  |  |  | |  |                                 |  | *** ||   |                       ***    ***                      |   |***    |   | |  |  |  |                             ..nest..                              ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche .. |   |      ****  **** ****                                 ****  ****|   |                              | |                      |   |       |   | ****  ****                             ..niche..                                          | ****  
search RasMol script viewer Motif-ligand binding stats  stmotif .. |   |                                                                *****                              | |                      |   |       |   |                                        ..stmotif..                                          |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple .. *****                                                                                                   | |                      *****       *****                                        ..ststaple..                                          *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                         ***                                                                               ..stturn..                                                  

chain A : NUCLEAR RECEPTOR SUBFAMILY 4 GROUP A MEMBER 1
member of: CATH:search1.10.565.10GENE3D:searchG3DSA_1.10.565.10PANTHER:searchPTHR24085/searchPTHR24085_SF1PFAM:searchPF00104PRINTS:searchHMRNUCRECPTR/searchNUCLEARECPTR/searchSTRDHORMONERSMART:searchSM00430SUPERFAMILY:searchSSF48508UniProt:searchP22736
JMol viewer RasMol script viewer  GOL 302A  ..           ** ***                                                                        *   *                                                                                          ..GOL ..                                                  
JMol viewer RasMol script viewer  GOL 301A  ..           || |||                                                                        |   |                                                      **                                  ..GOL ..                                                  
sec str:  ...hhhhhhhhhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eee.....eeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh... ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh..
sequence :  ..PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAG... ..ASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
seq num:  ..30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210 ... ..218       228       238       248       258       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           |  |   ^**| |  |                                || || ||| ||  || |   |         ||  ||  | |  | |||  |  ||                  | ||||   |   | |  |^**  |                          ..PS00005..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |    | | |  |                                || || ||| |^***| |   |         ||  ||  | |  | |||  |  ||                  | ||||   |   | |  |  |  |                          ..PS00006..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..           |  |    | | |  |                                || || ||| **********************|  ||  | |  | |||  |  ||                  | ||||   |   | |  |  |  |                          ..PS00029..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           |  |    | | |  |                                || || ||| ||   | |   |         ||  ||  | |  | |||  *****                  | ||||   |   | |  |  |  |                          ..alphabetamotif..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           |  |    | | |  |                                || || ||| ||   | |   |         ||  ||  | |  | |||  |  |                   | |||*****   | |  |  |  |                          ..asxmotif..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           |  |    | | |  |                                || || ||| ||   | |   |         ||  |******  *****  |  |                   | |||    |   | |  |  |  |                          ..betabulgeloop..      || ||                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****    | | |  |                                ********| ||   | |   |         ||  |   | |  ****|  ****                   ****|    |   | |  |  |  |                          ..betaturn..      *****                   ||||        | | ||  
search RasMol script viewer Motif-ligand binding stats  nest ..                   | | |  |                                 |  | *** ||   | |   |         ||  |   ***    ***                           ***    |   | |  |  |  |                          ..nest..                              ****        | | ||  
search RasMol script viewer Motif-ligand binding stats  niche ..                   *** ****                                 ****  ****|   | |   |         |****          | |                                  |   | ****  ****                          ..niche..                                          | ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                      ***** |   |         |   |          | |                                  |   |                                     ..stmotif..                                          |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                            *****         *****          | |                                  *****                                     ..ststaple..                                          *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                         ***                                                                            ..stturn..                                                  

   New search    3v3e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors