triangle PDBeMotif: 3uvd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.6.4.
Classification transcription    | release date: Tue, Nov 29, 2011
Title crystal structure of the bromodomain of human transcription brg1 (smarca4) in complex with n-methyl-2-pyrrolidone
Authors A.M.EDWARDS, C.BOUNTRA, C.H.ARROWSMITH, F.VON DELFT, I.FELLETAR, J.MUNIZ, J.WEIGELT, O.GIL, P.FILIPPAKOPOULOS, S.PICAUD, STRUCTURAL GENOMICS CONSORTIUM (SGC), T.KEATES
Method X-RAY DIFFRACTION (resolution: 1.85Å)
PDBe Citation   
Small molecules:    search MB3 MB3 binding statistics MB3
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
SMAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDL
EKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TRANSCRIPTION ACTIVATOR BRG1
member of: CATH:search1.20.920.10GENE3D:searchG3DSA_1.20.920.10PANTHER:searchPTHR10799/searchPTHR10799_SF76PFAM:searchPF00439PRINTS:searchBROMODOMAINPROSITE PATTERNS:searchPS00633, PROSITE PROFILES:searchPS50014, SMART:searchSM00297SUPERFAMILY:searchSSF47370UniProt:searchP51532
JMol viewer RasMol script viewer  MB3 1A  ..                                     **           *                                         **                            
sec str:  ..........hhhhhhhhhhhhhhhhhh.......hhhhhhh.......hhhhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..MAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKED
seq num:  ..1447      1457      1467      1477      1487      1497      1507      1517      1527      1537      1547      1557        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |     | ^***|       |  |    | |  |  |    | ||    |  |    |   |     |||| |  |            | |||  |              | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |     |  |^**       |  |    ^**  |  |    ^**|    |  |    |   |     |||| |  |            | |||  |              ^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..***     |  ||         |  |    | |  |  |    ^***    |  |    |   |     |||| ^***            | |||  |                        
search RasMol script viewer Motif-ligand binding stats  BROMODOMAIN_1 ..        |  ||         |  |    | |  **********************************************************||  |                        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****         |  |    | |  |  |            |  |    |   |     ||||                 |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        |  |          |  |    | |  |  |            |  |    *****     ||||                 |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****          |  |    | |  ****            |  |              ||||                 |  |****                        
search RasMol script viewer Motif-ligand binding stats  nest ..                      |  |    ***                  |  |              ****                 |  ||  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                      ****    | |                  ****               ***                 ********                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                              ***                                                                                         

   New search    3uvd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors