triangle PDBeMotif: 3urz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Tue, Nov 22, 2011
Title crystal structure of a putative protein binding protein (bac from bacteroides ovatus atcc 8483 at 2.19 a resolution
Authors JOINT CENTER FOR STRUCTURAL GENOMICS (JCSG)
Method X-RAY DIFFRACTION (resolution: 2.19Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search PG4 PG4 binding statistics PG4   search EDO EDO binding statistics EDO
Modified residues:  search CSX CSX binding statistics CSX search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GQSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKEL
LQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYAR
YRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVNR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : UNCHARACTERIZED PROTEIN
member of: GENE3D:searchG3DSA_1.25.40.10PFAM:searchPF13174/searchPF13414PROSITE PROFILES:searchPS50005/searchPS50293, SUPERFAMILY:searchSSF48452UniProt:searchA7LZ30
JMol viewer RasMol script viewer  ZN 260A  ..                                                                                                                   * *                            ..                                                        
JMol viewer RasMol script viewer  ZN 250A  ..                                                                                             *                     | |                            ..                                                        
sec str:  ..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhh
sequence :  ..SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYK..SPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN
seq num:  ..22        32        42        52        62        72        82        92        102       112       122       132       142       152       162   ..171       181       191       201       211       221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |          | | |   ||             |  || ||  |  |||  |        |||    |         |  | |           | |           |  |  |         |   |    ||   | |*..              ||  ||| |         |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |          | | |   ||             |  || ||  |  ^**  |        |||    |         |  | |           | |           |  |  |         |   |    ||   | | ..              ||  ^** |         |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***          | | |   ||             |  |^***  |   |   |        |||    |         |  | |           | |           |  |  |         |   |    ||   | | ..              ||  |^***         |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..              | | |   ||             |  || ||  |   |   |        |******^         |  | |           | |           |  |  |         |   |    *******^ ..              ||  ||            |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | | ^*****             |  || ||  |   |   |        | |              |  | |           | |           |  |  |         |   |     |   |   ..              ||  ||            |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  asxturn ..              | | |   |              |  || ||  |   |   |        | |              |  ***           | |           |  |  |         |   |     |   |   ..              ||  ||            |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  nest ..              *** |   |              |  || ||  |   |   |        ***              |  |             ***           |  |  |         |   |     |   |   ..              ||  ||            |  |   |   |            
search RasMol script viewer Motif-ligand binding stats  niche ..                  |   |              |  ********   |   |                         ****                           *******         |   |     |   |   ..              ||  ||            ****   |   |            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****              *****         *****                                                                        *****     *****   ..              ******                   *****            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : UNCHARACTERIZED PROTEIN
member of: GENE3D:searchG3DSA_1.25.40.10PFAM:searchPF13174/searchPF13414PROSITE PROFILES:searchPS50005/searchPS50293, SUPERFAMILY:searchSSF48452UniProt:searchA7LZ30
JMol viewer RasMol script viewer  EDO 301B  ..                                                                                                                    * *                                                                                       
JMol viewer RasMol script viewer  PG4 300B  ..                                 **                           *  * *                                                | |                                                                                       
JMol viewer RasMol script viewer  ZN 260B  ..                                 ||                           |  | |                                                * *                                                                                       
JMol viewer RasMol script viewer  ZN 250B  ..                                 ||                           |  | |                      *   *                     | |                                                                                       
sec str:  ...hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh
sequence :  ..QSVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDCLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKKLSSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN
seq num:  ..21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | || |   |    | | |    |       | |   |  || ||  |  |||  |        |||    |         |  | |           | |           |  |  |         |   |    |     ||**^*                  ||| |         |  | |   |              
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | || |   |    | | |    |       | |   |  || ||  |  ^**  |        |||    |         |  | |           | |           |  |  |         |   |    |     || |                    ^** |         |  | |   |              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^*** |   |    | | |    |       | |   |  |^***  |   |   |        |||    |         |  | |           | |           |  |  |         |   |    |     || |                     ^***         |  | |   |              
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |  |   |    | | |    |       | |   |  || ||  |   |   |        |******^         |  | |           | |           |  |  |         |   |    *******^ |                                  |  | |   |              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |  |   |    | | ^*****       | |   |  || ||  |   |   |        | |              |  | |           | |           |  |  |         |   |          |  |                                  |  | |   |              
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |  |   |    | |              ***   |  || ||  |   |   |        | |              |  ***           | |           |  |  |         |   |          |  |                                  |  | |   |              
search RasMol script viewer Motif-ligand binding stats  nest .. | |  |   |    ***                    |  || ||  |   |   |        ***              |  |             ***           |  |  |         |   |          |  |                                  |  | |   |              
search RasMol script viewer Motif-ligand binding stats  niche .. | |  |   |                           |  ********   |   |                         ****                           *******         |   |          ****                                  **** |   |              
search RasMol script viewer Motif-ligand binding stats  stmotif .. | |  |   |                           |   |         |   |                                                                        |   |                                                     *****              
search RasMol script viewer Motif-ligand binding stats  ststaple .. | |  *****                           *****         *****                                                                        *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn .. ***                                                                                                                                                                                                          

   New search    3urz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors