triangle PDBeMotif: 3ugm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription/dna    | release date: Wed, Nov 2, 2011
Title structure of tal effector pthxo1 bound to its dna target
Authors A.J.BOGDANOVE, A.N.S.MAK, B.L.STODDARD, P.BRADLEY, R.A.CERNADAS
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MASSHHHHHHSSGLVPRGSSGSSMAARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKPKVRSTVAQHHEA
LVGHGFTHAHIVALSQHPAALGTVAVTYQHIITALPEATHEDIVGVGKQWSGARALEALLTDAGELRGPPLQLDTGQLVK
IAKRGGVTAMEAVHASRNALTGAPLNLTPAQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALE
TMQRLLPVLCQAHGLPPDQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQA
HGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIA
SNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQ
QLLPVLCQAHGLTPDQVVAIASNIGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGL
TPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHD
GGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQEQVVAIASNNGGKQALETVQRL
LPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTL
AQVVAIASNIGGKQALETVQRLLPVLCQAHGLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGG
KQALETVQRLLPVLCQDHGLTLDQVVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSGGKQALETVQRLLPV
LCQDHGLTPNQVVAIASNGGKQALESIVAQLSRPDPALAALTNDHLVALACLGGRPAMDAVKKGLPHAPELIRRVNRRIG
ERTSHRV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : TAL EFFECTOR AVRBS3/PTHA
member of: PFAM:searchPF03377UniProt:searchB2SU53
sec str:  ..............................................hhhhhhhhh...hhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh..hhhhhhhhhhhhhhhhhhh...hhhhhh......hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh...hhhhhhhhhhhhhhhhh....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhh...hhhhhhhhhhhhhhhh.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh..hhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhh...hhhhhh......hhhhhhhhhhhhh.... ....hhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhhhhh..hhhhhhhhhhh...........hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhhhhhh................
sequence :  ..KPKVR..E..LV..AHIVALSQHPAALGTVAVTYQHIITAL..ATHEDIVGVGKQWSGARALEALLTDAGELRGPPLQLDTGQLVKIAKRGGVTAMEAVHASRNALT..PLNLTPAQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETMQRLLPVLCQAHGLPPDQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQQLLPVLCQAHGLTPDQVVAIASNIGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLP... ..GLTQEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLAQVVAIASNIGGKQALETVQRLLPVLCQ..GLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLDQVVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSG
seq num:  ..169  ..181..183..191       201       211    ..220       230       240       250       260       270       280 ..286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786  ... ..797       807       817       827       837       847       857       867       877       887       897       907       917       927 ..933       943       953       963       973       983       993       1003      1013      1023      1033      1043  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     .. ..  ..   | |        | | |        .. | |||  || | | |  |||  ||      | |   | |||||   |  | ||          ..   |    |  |    |    | |  ||       |||   || ||| | |||| ||| ||  |  || | ||| |||      || ||| ||  |   |  |   |  | | |||| |||||| |           | |     |  ||  |||||| ||             |  || ||    | || | ||  |       | ||   ||  || |  | | |||     |  || ||   ||   |  |  | | |           |||| |||  || | |  | | |               |  |  || | | || | |     |  |     ||| || || | |    |        |  | | |     |   |  |  | | |           | | |  || |||| ||| ||  ||          | |||||  |  | | || | |||   |  || | ||| |||      || ||| |||    ..PS00005..  | |  ||  |  |  | | ||      |  |   | |    |  | || ||| |||         |||   ||  || | | |  ||  ||        |||   | | | || | |  |  ||  |  |  ..  |   || | || | |  |       |  ||        |  ||   |    |             | ||  ||  ||  |  | | |      |  |    | |         |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     .. ..  ..   | |        | | |        .. ^***|  || | | |  |||  ||      | |   | |||||   |  ^***          ..   |    |  |    |    | |  ||       |||   || ||| | |||| ||| ||  |  || | ||| |||      || ||| ||  |   |  |   |  | | |||| |||||| |           | |     |  ||  |||||| ||             |  || ||    | || | ||  |       | ||   ||  || |  | | |||     |  || ||   ||   |  |  | | |           |||| |||  || | |  | | |               |  |  || | | || | |     |  |     ||| || || | |    |        |  | | |     |   |  |  | | |           | | |  || |||| ||| ||  ||          | |||||  |  | | || | |||   |  || | ||| |||      || ||| |||    ..PS00006..  | |  ||  |  |  | | ||      |  |   | |    |  | || ||| |||         |||   ||  || | | |  ||  ||        |||   | | | || | |  |  ||  |  |  ..  |   || | || | |  |       |  ||        |  ||   |    |             | ||  ||  ||  |  | | |      |  |    | |         |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     .. ..  ..   | |        | | |        .. | | |  || | | |  |||  ||      | |   | |||||   ^*****           ..****    |  |    ^***** |  ||       |^*****| ||| | ^*****|| ||  |  || | ||| |||      ^***** ||  |   |  |   |  | | |||| ^***** |           | |     |  ||  ^***** ||             |  || ||    ^***** ||  |       | ||   ||  || ^***** |||     |  || ||   ||   |  ^***** |           |^*****|  || | ^***** |               |  |  || | ^***** |     |  |     ||| || || | ^*****        |  | | |     |   |  ^***** |           | | |  || |||| ^*****  ||          ^*****|  |  | ^***** |||   |  || | ||| |||      ^***** |||    ..PS00008..  | |  ||  |  ^***** ||      |  |   | |    |  | ^***** |||         |^*****|  || | ^*****|  ||        |^***** | | || ^*****  ||  |  |  ..  |   || | || ^*****       |  ||        |  ||   ^*****             | ||  ||  ||  ^***** |      |  |    | |         ^
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     .. ..  ..   | |        | | |        .. | | ***** | | **********      | |   *******                    ..        |  |           *****       | |   |***** | ||||  *****  ***** | |******       ***** ||  |   |  |   |  | *****| *****  |           | |     *****  |||||| ||             |  *****    | ||   ||  |       | ||   |*****    | *****     ***** ||   ||   |     |   |           | || | ***** |    |   |               |  ***** | | ||   |     |  |     |******** | |             |  | | |     |   |     |   |           | | |  *****|| ||| |*****            ||| |  |  | | || *****   ***** | ||*****       | ||*****    ..alphabetamotif..  | |  ||  |     | | ||      |  |   | |    |  |  | |******         | |    ***** | | |   *****        | |     | | || | |  *****  |  |  ..  |   || | || | |          *****        *****                      | |*********     |   |      |  |    | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..     .. ..  ..   | |        | | |        .. | | |  |  | | |  | |  |       | |   | || |                     ..        |  |           |  |        | |   || ||  | ||||  || |   |  |  | ||| ||        | ||  ||  |   |  |   |  | | || | |||||  |           | |     |  |   |||||| ||             |  || |     | ||   ||  |       | ||   ||  |     | | ||      |  || ||   ||   |     |   |           | || | |  |  |    |   |               |  |  |  | | ||   |     |  |     ||| |  || ***             |  | | |     |   |     |   |           | | |  || | || ||| ||  |             ||| |  |  | | || | ||    |  |  | ||| ||        | ||| ||     ..asxturn..  | |  ||  |     | | ||      |  |   | |    |  |  | ||| ||          | |    |  |  | | |   |  |         | |     | | || | |  |  |   |  |  ..  |   || | || | |          |  |         |  |                       | ||  ||  |      |   |      |  |    | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..     .. ..  ..   | |        | | |        .. | | ****  | | **** ****       | |   ******                     ..        ****           ****        | |   *****  ****||  ****   ****  | |*****        ****  |****   ****   **** **** | *****  |           | |     ****   |********             |  ****     | ||   |****       | ||   |****     | ****      ****| ||   ||   |     |   |           | || | ****  |    |   |               *******  | | ||   |     ****     |*******| |               **** | |     |   |     |   |           | | ******* || |********             |****  |  | | || ****    ****  | |*****        ********     ..betaturn..  | |  |****     | ****      |  |   | |    |  |  ********          | |    ****  | | |   ****         | |     | | || | |  ****   ****  ..  |   || | || | |          ****         ****                       | |********      |   |      ****    | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     .. ..  ..   ***        | | |        .. | |    |  | | |               ***                              ..                                   | |       |  | | ||   |           | |               |   |                     |  | | ||   |           | |            | ||   |              |   |       | ||   |           | ||   |         |   |           | ||   ||   |     |   |           | || |    |  |    |   |                     |  | | ||   |              | |     | |                    ***     |   |     |   |           | |     | | |*** |                   | |    |  | | ||   |           | |               |   |      ..gammaturn..  | |  |   |     |   |       |  |   | |    |  |    |   |           | |       |  | | |                | |     | | || | |               ..  |   || | || | |                                                  | |              |   |              | |          
search RasMol script viewer Motif-ligand binding stats  nest ..     .. ..  ..              *****        .. | |    |  | ***                                                ..                                   ***       |  | ***|   |           ***               |   |                     |  | ***|   |           ***            ***|   |              |   |       ***|   |           ***|   |         |   |           ***|   ||   |     |   |           ***| |    |  |    |   |                     |  | ***|   |              | |     | |                            |   |     |   |           ***     | | || ***                   | |    |  | ***|   |           ***               |   |      ..nest..  | |  |   |     |   |       |  |   | |    |  |    |   |           | |       |  | ***                ***     | | || ***               ..  |   || | || ***                                                  ***              |   |              | |          
search RasMol script viewer Motif-ligand binding stats  niche ..     .. ..  ..                           .. | |    ****                                                    ..                                             ****    |   |                             |   |                     ****    |   |                             |   |              |   |          |   |              |   |         |   |              |   ||   |     |   |              | |    ****    |   |                     ****    |   |              | |     ***                            |   |     |   |                   | ****                       | |    ****    |   |                             |   |      ..niche..  | |  |   |     |   |       ****   | |    ****    |   |           ***       ****                            | ****                   ..  |   || ****                                                                       |   |              | |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..     .. ..  ..                           .. | |                                                            ..                                                     |   |                             |   |                             |   |                             |   |              *****          |   |              *****         |   |              *****|   |     |   |              | |            |   |                             |   |              | |                                    |   |     |   |                   |   |                        | |            |   |                             |   |      ..stmotif..  | |  |   |     |   |              | |            |   |                                                     |   |                    ..  *****|   |                                                                        |   |              | |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..     .. ..  ..                           .. | |                                                            ..                                                     *****                             *****                             *****                             *****                             *****                            *****                   *****     *****              | |            *****                             *****              | |                                    *****     *****                   *****                        | |            *****                             *****      ..ststaple..  | |  *****     *****              | |            *****                                                     *****                    ..       *****                                                                        *****              | |          
search RasMol script viewer Motif-ligand binding stats  stturn ..     .. ..  ..                           .. ***                                                            ..                                                                                                                                                                                                                                                                                   ***                                                                 ***                                                                                                   ***                                                         ..stturn..  ***                               ***                                                                                               ..                                                                                                       ***          

chain B : DNA-1
sec str:  ........................................
sequence :  ..TAGATATGCATCTCCCCCTACTGTACACCACCAAAAGT
seq num:  ..-6        4         14        24      

chain C : DNA-2
sec str:  ........................................
sequence :  ..TTTTGGTGGTGTACAGTAGGGGGAGATGCATATCTAAC
seq num:  ..1         11        21        31      

   New search    3ugm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors