triangle PDBeMotif: 3uf2  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cytokine    | release date: Mon, Oct 31, 2011
Title crystal structure of the human colony-stimulating factor 1 ( cytokine
Authors J.ELEGHEERT, S.N.SAVVIDES
Method X-RAY DIFFRACTION (resolution: 2.75Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F,G,H,I,J sequence:
GSHMEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIA
IVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ...hhhhh...hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh..
sequence :  ..VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
seq num:  ..3         13        23        33        43        53        63        73        83          ..100       110       120       130       140     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |         | | || || |        |  | |         |  |     | | |  |   |    |   | ||| ||   ..|  | |  ||   |      | ^***     | ||  |  ^*** || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |         | | || || |        |  | |         |  |     ^** |  |   |    |   ^**|| ||   ..|  | |  ||   |      |   |      | ||  |    || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |         | | ^***| |        |  | |         |  |         |  |   |    |   |  || ||   ..|  | ^***|   |      |   |      | ||  |    ^***| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |         | | ||  | |        |  | |         |  |         |  |   |    |   |  *****   ..|  |     |   |      |   |      | ||  |     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | |         | | ||  | |        |  | |         |  |         |  |   |    |   |  || ||   ..|  |     |   |      |   |      ***|  |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |         | | ||  | |        |  | |         ****         |  |   |    |   |  ****|   ..|  |     |   |      |   |         |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..      ***         | ****  ***        ******                      ****   |    |   |   ****   ..****     |   |      |   |         ****     **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  |   |                                             *****    |   |          ..         *****      |   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                      *****          ..                    *****                       

chain B : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ........hhhhhhhhhhhhhhh......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.
sequence :  ..YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..EHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC
seq num:  ..6         16        26        36        46        56        66        76        86       ..97        107       117       127       137       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |           | || |          ||| | |                  | | |  |   |        | ||| ||   ..  ||| | |  ||   |  ||  | ^***        |  |  ^*** | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |           | || |          ||| | |                  ^** |  |   |        ^**|| ||   ..  ||| | |  ||   |  ||  |   |         |  |    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |           | ^***          ||| | |                  | | |  |   |           || ||   ..  ||| | ^***|   |  ||  |   |         |  |    ^*** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   | |           |  |            ||| | |                  | | |  |   |           || ||   ..  ||| |     |   *****  |   |         |  |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |           |  |            *** | |                  | | |  |   |           || ||   ..  ||| |     |   |  |   |   |         |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |           |  |             |  | |                  | | ****   |           *****   ..  ||| |     |   ****   |   |         |  |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |           |  |             |  | |                  *** |  |   |            |  |   ..  *** |     |   |      |   |         |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..   ***           ****             ******                      ****   |            ****   ..  *****     |   |      |   |         ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                 *****                   ..            *****      |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                         ..                       *****                      

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  .........hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh..
sequence :  ..EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                | | || || |       ||| | |   |              | | |  |   |    |   | ||| ||  | || ||  | |  ||   |      | ^*** |  ||  |  |  ^*** |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                | | || || |       ||| | |   |              ^** |  |   |    |   ^**|| ||  | || ||  | |  ||   |      |   |  |  ||  |  |    |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                | | ^***| |       ||| | |   |                  |  |   |    |   |  || ||  | || ||  | ^***|   |      |   |  |  ||  |  |    ^***  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                | | ||  | |       ||| | |   |                  |  |   |    |   |  || ||  | || ||  |     |   |      |   |  *****  |  |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                | | ||  | |       ||| | *****                  |  |   |    |   |  || ||  | || ||  |     |   |      |   |  |  |   |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                | | ||  | |       *** | |                      |  |   |    |   |  || ||  | || ||  |     |   |      |   |  |  |   |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                | | ||  | |        |  | |                      ****   |    |   |  *****  | || ||  |     |   |      |   |  ****   |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                | ****  ***        ******                      ****   |    |   |   ****  **********     |   |      |   |         ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                |   |   | |                                       *****    |   |                        *****      |   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****   | |                                                *****                                   *****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                        ***                                                                                                                    

chain D : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ........hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.
sequence :  ..YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC
seq num:  ..6         16        26        36        46        56        66        76        86       ..100       110       120       130       140    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |         | | || || |       ||| | |                  | | |  |        |   | ||| ||   ..|  | |  ||   |      | ^***  |  | || ||  ^*** | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |         | | || || |       ||| | |                  ^** |  |        |   ^**|| ||   ..|  | |  ||   |      |   |   |  | || ||    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   | |         | | ^***| |       ||| | |                  | | |  |        |   |  || ||   ..|  | ^***|   |      |   |   |  | || ||    ^*** 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   | |         | | ||  | |       *** | |                  | | |  |        |   |  || ||   ..|  |     |   |      |   |   |  ***| ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |         | | ||  | |        |  | |                  | | ****        |   |  ****|   ..|  |     |   |      |   |   |  | ****|         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |         | | ||  | |        |  | |                  *** |  |        |   |   |  |   ..|  |     |   |      |   |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..   ***         | | ||  | |        |  | |                      |  |        |   |   |  |   ..|  |     |   |      |   |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..   ***         | ****  ***        ******                      ****        |   |   ****   ..****     |   |      |   |   ****  ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..               |   |                                                      |   |          ..         *****      |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****                                                      *****          ..                    *****                      

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ....hhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.............eeeeeehhhhhhhhhhhhhhhhhhhhh...hhhhh.hhhhhhhh..
sequence :  ..VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDY..DKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
seq num:  ..3         13        23        33        43        53        63        73        83        93 ..99        109       119       129       139       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  |              | || || |        |  | |   |  |  ||       | | |  |        |   | ||| ||    .. |  | |  ||   |      | ^***  |  | ||  |  ^*** ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  |              | || || |        |  | |   |  |  ||       ^** |  |        |   ^**|| ||    .. |  | |  ||   |      |   |   |  | ||  |    || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  |              | ^***| |        |  | |   |  |  ||           |  |        |   |  || ||    .. |  | ^***|   |      |   |   |  | ||  |    ^***|  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |              |  |  | |        |  | |   |  *****           |  |        |   |  || ||    .. |  |     |   |      |   |   |  | ||  |     |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |              |  |  | |        |  | *****  |  |            |  |        |   |  || ||    .. |  |     |   |      |   |   |  | ||  |     |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |              |  |  | |        |  | |      |  |            |  |        |   |  || ||    .. |  |     |   |      |   |   |  ***|  |     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****              |  |  | |        |  | |      ****            ****        |   |  ****|    .. |  |     |   |      |   |   |  |  |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****  ***        ******                      ****        |   |   ****    .. ****     |   |      |   |   ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                             |   |           ..          *****      |   |                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****           ..                     *****                        

chain F : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ...hhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.
sequence :  ..SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC
seq num:  ..4         14        24        34        44        54        64        74        84         ..100       110       120       130       140    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                   | || || |       ||| | |      |  ||     | ||| |  |   |    |   | ||| ||   ..|  | |  ||   |      | ^***  |  |  |  |  ^*** | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                   | || || |       ||| | |      |  ||     | ^** |  |   |    |   ^**|| ||   ..|  | |  ||   |      |   |   |  |  |  |    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   | ^***| |       ||| | |      |  ||     |  |  |  |   |    |   |  || ||   ..|  | ^***|   |      |   |   |  |  |  |    ^*** 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |  |  | |       ||| | |      *****     |  |  |  |   |    |   |  || ||   ..|  |     |   |      |   |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   |  |  | |       *** | |      |  |      |  |  |  |   |    |   |  || ||   ..|  |     |   |      |   |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |  |  | |        |  | |      ****      |  |  ****   |    |   |  ****|   ..|  |     |   |      |   |   |  |  ****         
search RasMol script viewer Motif-ligand binding stats  niche ..                   ****  ***        ******                ****  ****   |    |   |   ****   ..****     |   |      |   |   ****  ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                   *****    |   |          ..         *****      |   |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                            *****          ..                    *****                      

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain G : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ....hhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh..
sequence :  ..SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                   | |||| |            | |      |  ||  ||   | | |  |  ||        | ||| ||        |  | |  ||  || ||   | ^***  |  | ||  |  ^*** || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                   | |||| |            | |      |  ||  ||   ^** |  |  ||        ^**|| ||        |  | |  ||  || ||   |   |   |  | ||  |    || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   | ^*** |            | |      |  ||  ||   | | |  |  ||           || ||        |  | ^***|  || ||   |   |   |  | ||  |    ^***| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |  ||  |            | |      *********   | | |  *****           || ||        |  |     |  *****   |   |   |  | ||  |     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   |  ||  |            | |      |  ||  |    | | |  |  |            || ||        |  |     |  || |    |   |   |  ***|  |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |  ||  |            | |      ********    | | *******            ****|        |  |     |  ****    |   |   |  |  |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                   |  ||  |            | |                  *** |  |                |  |        |  |     |   |      |   |   |  |  |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                   ********            ***                      ****                ****        ****     |   |      |   |   ****  ****     **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                         *****      |   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                    *****                       

chain H : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ..hhhhhh.hhhhhhhhhhhhhhh......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhh
sequence :  ..EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYE..ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC
seq num:  ..5         15        25        35        45        55        65        75        85          ..101       111       121       131       141   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |             | || || |        |  | |                  | | |  |        |   | | |  |     ..    |  ||   |        ^***     | ||  |  ^*** | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |             | || || |        |  | |                  ^** |  |        |   ^** |  |     ..    |  ||   |                 | ||  |    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |             | ^***| |        |  | |                      |  |        |   |   |  |     ..    ^***|   |                 | ||  |    ^*** 
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |             |  |  | |        |  | |                      |  |        |   |   |  |     ..        |   |                 ***|  |         
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****             ****  | |        |  | |                      ****        |   |   ****     ..        |   |                    |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****  ***        ******                      ****        |   |   ****     ..        |   |                    ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                           |   |            ..        *****                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                           *****            ..                                              

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain I : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ...hhhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhh...
sequence :  ..VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
seq num:  ..3         13        23        33        43        53        63        73        83          ..100       110       120       130       140     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |  |  ||      | || || |       ||| | |                  | | |  |   |        | ||| ||   ..|  | |  ||   |      | ^***  |  | ||  |  ^*** || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  |  |  ||      | || || |       ||| | |                  ^** |  |   |        ^**|| ||   ..|  | |  ||   |      |   |   |  | ||  |    || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |  |  ||      | ^***| |       ||| | |                      |  |   |           || ||   ..|  | ^***|   |      |   |   |  | ||  |    ^***| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |  *****      |  |  | |       ||| | |                      |  |   |           *****   ..|  |     |   |      |   |   |  | ||  |     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |  |  |       |  |  | |       *** | |                      |  |   |           || ||   ..|  |     |   |      |   |   |  ***|  |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****  ****       |  |  | |        |  | |                      ****   |           ****|   ..|  |     |   |      |   |   |  |  |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****  ***        ******                      ****   |            ****   ..****     |   |      |   |   ****  ****     **** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    *****                   ..         *****      |   |                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                            ..                    *****                       

chain J : MACROPHAGE COLONY-STIMULATING FACTOR 1
member of: PANTHER:searchPTHR10058PFAM:searchPF05337PIRSF:searchPIRSF001948SUPERFAMILY:searchSSF47266UniProt:searchP09603
sec str:  ...hhhhh...hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh..........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh..
sequence :  ..VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD..ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS
seq num:  ..3         13        23        33        43        53        63        73        83          ..101       111       121       131       141    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                 |  |||| || |       ||| |                    | | |  |   |    |   | ||| ||   ..    |  ||   |        ^***  |  |  |  |  ^*** |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                 |  |||| || |       ||| |                    ^** |  |   |    |   ^**|| ||   ..    |  ||   |              |  |  |  |    |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                 |  ||^***| |       ||| |                    | | |  |   |    |   |  || ||   ..    ^***|   |              |  |  |  |    ^***  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 ***** |  | |       ||| |                    | | |  |   |    |   |  *****   ..        |   |              |  |  |  |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |  |  | |       *** |                    | | |  |   |    |   |  || ||   ..        |   |              |  |  |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 *******  | |        |  |                    | | ****   |    |   |  ****|   ..        |   |              |  |  |  |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                    |  |  | |        |  |                    *** |  |   |    |   |   |  |   ..        |   |              |  |  |  |          
search RasMol script viewer Motif-ligand binding stats  niche ..                    ****  ***        ****                        ****   |    |   |   ****   ..        |   |              ****  ****          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                    *****    |   |          ..        *****                                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                             *****          ..                                               

   New search    3uf2:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors