triangle PDBeMotif: 3udb  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.11.1
Classification transferase    | release date: Thu, Oct 27, 2011
Title crystal structure of snrk2.6
Authors C.YAN, R.REN, T.XIE, Y.PANG
Method X-RAY DIFFRACTION (resolution: 2.57Å)
PDBe Citation   
Small molecules:    search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
MDRPAVAGPMDLPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRF
KEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIAD
FGYSKASVLHSQPKSAVGTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAI
PDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMNDNTMTTQFDESDQPGQSIEEIMQIIAEATV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318A  ..                                                                                                                                                        ..CL ..                                                                                                           ..                
sec str:  ...........eeeeee.........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeeee..eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhh.hhhhhh..........hhhhhhhhhhhhh.
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADL..GQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279    ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |            | |       |                | ||||||  |        |  |        |  |           |  |          |    |  ||| |||||||| ||       |     |..PS00004..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || **^*  || || |||| |    ..  |  |     || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |            | |       |                | ||^**|  |        |  |        |  |           |  |          |    |  ||| |||||||| ||       |     |..PS00005..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..  |  |     || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |||||     |            | |       |                | |||| |  |        |  |        ^***           ^***          |    |  ||| |||||||^***       |     |..PS00006..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || ^***| || |||| |    ..  ^***     || ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |||||     |            | |       |                | |||| |  |        |  |                                     |    |  ||| |||||||  |        ******^..PS00007..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |||||     |            | |       |                | |||| |  |        |  |                                     ^*****  ||| |||||||  |               ..PS00008..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |||||     ************************                | |||| |  |        |  |                                          |  ||| |||||||  |               ..PS00107..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     |||||                  | |                        | |||| |  |        |  |                                          |  |****^********               ..PS00108..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                  | |                        *****| |  |        |  |                                          |  | | |||||||                  ..alphabetamotif..||  |   |  |   | |    *****      | |          | |    || |||   |  |  |   | ***** | ***** |  || |*****| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |||||                  | |                        | || | |  |        |  |                                          |  | | |||||||                  ..asxturn..||  |   |  |   ***    |  |       | |          ***    || |||   |  |  |   | |  |  | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|                  | |                        **** | |  |        |  |                                          |  | | |||||||                  ..betaturn..||  |   |  |          ****       | |                 |****|   |  |  |   | ****  | ****| |  ********|| |    ..           *****
search RasMol script viewer Motif-ligand binding stats  nest ..     *** |                  | |                          |  | |  |        |  |                                          |  | ***|****|                  ..nest..||  |   |  |                     ***                 |  ***   |  |  |   |       | ||  | |   |  | | || |    ..                
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                  ***                          **** ****        ****                                          ****    | |  |                  ..niche..|****   ****                                         |    |   ****  |   |       ******* |   **** ******    ..                
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                | |  |                  ..schellmannloop..|                                                    ******         |   |               |   |              ..                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                | |  |                  ..stmotif..|                                                                   *****               *****              ..                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                          ..                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318B  ..                                                                                                                                                        ..CL ..                                                                                                            ..                  
sec str:  ...........eeeeeee.......eeeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ........hhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhhhhhhhhh............hhhhhhhhhhhhh.
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..GTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADL..QPGQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..178       188       198       208       218       228       238       248       258       268       278     ..300       310     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |               | |    |  | |             | ||||  |        |  |        |  |  ||       |  ||         |    |  ||   ||||||| ||       |     |..PS00004.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || **^*  ||  | | || |    ..    |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |               | |    |  | |             | ^**|  |        |  |        |  |  ||       |  ||         |    |  ||   ||||||| ||       |     |..PS00005.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |  ||  | | || |    ..    |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |||     |               | |    |  | |             |  | |  |        |  |        ^***  ||       ^***|         |    |  ||   ||||||^***       |     |..PS00006.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || ^***|  | | || |    ..    ^***|         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |||     |               | |    |  | |             |  | |  |        |  |           |  ||       |   |         |    |  ||   ||||||  |        ******^..PS00007.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |||     |               | |    |  | |             |  | |  |        |  |           |  ||       |   |         ^*****  ||   ||||||  |               ..PS00008.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |||     ************************  | |             |  | |  |        |  |           |  ||       |   |              |  ||   ||||||  |               ..PS00107.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |||                     | |       | |             |  | |  |        |  |           |  ||       |   |              |  |****^********               ..PS00108.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                     | |       | |             |  | |  |        |  |           *****       |   |              |  |    ||||||                  ..alphabetamotif.. ||| |          | |    *****      | |       || |      || |||   |  |              | ***** |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | ||                      | |       | |             |  | |  |        |  |           |  |        |   |              |  |    ||||||                  ..asxturn.. ||| |          ***    |  |       | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                      | |       | |             |  | |  |        |  |           ****        |   |              |  |    ||****                  ..betaturn.. ||| |                 ****       | |       || |      |****|   |  |              | ****| |   **** | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                       | |       ***             |  | |  |        |  |                       |   |              |  |    ||||||                  ..gammaturn.. ||| |                            | |       |***      |  | |   |  |              | ||  | |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                       ***                       |  | |  |        |  |                       |   |              |  |    |****|                  ..nest.. ||| |                            ***       |  |      |  ***   |  |              | ||  | |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         **** ****        ****                       |   |              ****    | |  |                  ..niche.. |****                                      ****      |    |   ****              ******* |   **** ******    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     |   |                      | |  |                  ..schellmannloop.. | |                                                  ******                             |   |              ..    |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif.. | |                                                                                     *****              ..    *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                | |  |                  ..stturn.. ***                                                                                                        ..                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000.. *                                                                                                          ..                  

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318C  ..                 ..                                                                               *                      ..                     ..                                         ..CL ..                                                                ..                
sec str:  ...........eeeeeee....eeeeee....eeeeeeeee.hhhhhhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhee.......ee..........hhhhhhh...hhhhhhhhhhhhhhhhhhhh......... ....hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh...........hhhhhhhhhhhhhh
sequence :  ..LPIMHDSDRYELVKDIG..VARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQ..DLKLENTLLDGSPAPRLKIAD..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFED... ..PKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLM..GQSIEEIMQIIAEATV
seq num:  ..12        22     ..34        44        54        64        74        84        94        104       114       124         ..140       150        ..179       189       199       209        ... ..223       233       243       253       263       273       283 ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    | ||||  |                    |  |           |  ||         |    |   ..| |  || ||       |   ..||  | | ||||   | |    |  ||      | |     ..PS00004..  |  ||     | |   |  |              | || **^*  ||  | |||| |     ..  |  ||    || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     | ..      | |       |     |  || |||    | ^**|  |                    |  |           |  ||         |    |   ..| |  || ||       |   ..||  | | ||||   | |    |  ||      | |     ..PS00005..  |  ||     | |   |  |              | || || |  ||  | |||| |     ..  |  ||    || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    |  | |  |                    ^***           ^***|         |    |   ..| |  |^***       |   ..||  | | ||||   | |    |  ||      | |     ..PS00006..  |  ||     | |   |  |              | || || ^***|  | |||| |     ..  ^***|    || ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    |  | |  |                                   |   |         |    |   ..| |  |  |        ****..||  | | ||||   | |    |  ||      | |     ..PS00007..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |||||     | ..      | |       |     |  || |||    |  | |  |                                   |   |         ^*****   ..| |  |  |            ..||  | | ||||   | |    |  ||      | |     ..PS00008..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |||||     **..*****************     |  || |||    |  | |  |                                   |   |                  ..| |  |  |            ..||  | | ||||   | |    |  ||      | |     ..PS00107..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     |||||       ..      | |             |  || |||    |  | |  |                                   |   |                  ..^********            ..||  | | ||||   | |    |  ||      | |     ..PS00108..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****       ..      | |             |  |*****    |  | |  |                                   |   |                  ..| |  |               ..||  | *****|   | |    *****      | |     ..alphabetamotif..  *****     | |   |  |              | ***** |   |  *****| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |||||       ..      | |             |  || ||     |  | |  |                                   |   |                  ..| |  |               ..||  | | || |   ***    |  |       | |     ..asxturn..  |  |      | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|       ..      | |             |  *****     |  | |  |                                   |   |                  ..| |  |               ..||  | **** |          ****       | |     ..betaturn..  ****      | |   |  |              | ****| |   *******|| |     ..  |   |    *****
search RasMol script viewer Motif-ligand binding stats  nest ..     *** |       ..      | |             |  |         |  | |  |                                   |   |                  ..| |  |               ..||  |   |  |                     ***     ..nest..            ***   |  |              | ||  | |   |  | | || |     ..  |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ..      ***             ****         **** ****                                   |   |                  ..| |  |               ..|****   ****                             ..niche..                  ****              ******* |   **** ******     ..  |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 ..                                                                               *****                  ..| |  |               ..|                                        ..stmotif..                                            *****               ..  *****         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                 ..                                                                                                      ..* *  *               ..*                                        ..REP00000..                                                                ..                

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318D  ..                                                                                                                                                        ..CL ..                                                                                                         ..                      
sec str:  ...........eeeeee.........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeeee..eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...........ee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhh.hhhhhh......hhhhh...hhhhhhhhhhhhhh
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPA..DESDQPGQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279  ..296       306         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |            | |       |                  | ||||  |                    |  |  |        |  ||         |    |  ||   | || || || | |   |     |..PS00004..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | || **^*  || || |||| |  ..|       |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |            | |       |                  | ^**|  |                    |  |  |        |  ||         |    |  ||   | || || || | |   |     |..PS00005..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..|       |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |||     |            | |       |                  |  | |  |                    ^***  |        ^***|         |    |  ||   | || |^*** | |   |     |..PS00006..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | ^***| || |||| |  ..*       ^***|    |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |||     |            | |       |                  |  | |  |                       |  |        |   |         |    |  ||   | || |  |  | |   ******^..PS00007..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |||     |            | |       |                  |  | |  |                       |  |        |   |         ^*****  ||   | || |  |  | |          ..PS00008..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |||     ************************                  |  | |  |                       |  |        |   |              |  ||   | || |  |  | |          ..PS00107..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |||                  | |                          |  | |  |                       |  |        |   |              |  |****^********  | |          ..PS00108..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                  | |                          |  | |  |                       |  |        |   |              |  |    | || |     | |          ..alphabetamotif..||  |   |  | |        *****      | |    | ||  |         | |   |  |              | ||  | |  || |*****| |  ..        *****    |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | ||                   | |                          |  | |  |                       |  |        |   |              |  |    | || |     | |          ..asxturn..||  |   |  | |        |  |       | |    ***|  |         | |   |  |              | ||  | |  || || |||| |  ..        |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                   | |                          |  | |  |                       ****        |   |              |  |    | || |     | |          ..betaturn..|****   |  | |        ****       | |       ****         | |   |  |              | ||  | |  ********|| |  ..        ****     **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                    | |                          |  | |  |                                   |   |              |  |    | |***     | |          ..gammaturn..||  |   |  | |                   | |       |  |         | |   |  |              | ||  | |   |  | | || |  ..                      
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                    | |                          |  | |  |                                   |   |              |  |    | |  |     | |          ..nest..||  |   |  | |                   ***       |  |         ***   |  |              | ||  | |   |  | | || |  ..                      
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***                          **** ****                                   |   |              ****    | |  |     ***          ..niche..|****   ******                             ****               ****              ******* |   **** ******  ..                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif..|                                                                                       *****            ..                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                        ..                      

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318E  ..                ..                                                                               *                      ..                 ..                                       ..CL ..                                                                  ..               
sec str:  ..........eeeeee......eeeee....eeeeeeeee.......hhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......ee.......ee....................hhhhhhhhhhhhhhhhhhh....... .....hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhh......hhhhhhhhhh.
sequence :  ..PIMHDSDRYELVKDIG..VARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQ..LENTLLDGSPAPRLKIA..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPF... ..EPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMN..GQSIEEIMQIIAEAT
seq num:  ..13        23    ..34        44        54        64        74        84        94        104       114       124         ..143       153    ..179       189       199       209      ... ..222       232       242       252       262       272       282   ..302       312  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||||      | ..         | |    |      | | |       | ||||  |        |  |        |  |           |  ||         |    |   ..  || ||       |  ..||  |                 |  ||      | |   ..PS00004..          || |||   |  |              | |||**^*  || || | || |      ..  | || |  |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |^**      | ..         | |    |      | | |       | ^**|  |        |  |        |  |           |  ||         |    |   ..  || ||       |  ..||  |                 |  ||      | |   ..PS00005..          || |||   |  |              | ||||| |  || || | || |      ..  | || |  |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |       | ..         | |    |      | | |       |  | |  |        |  |        ^***           ^***|         |    |   ..  |^***       |  ..||  |                 |  ||      | |   ..PS00006..          || |||   |  |              | ||||| ^***| || | || |      ..  ^*** |  |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | |       | ..         | |    |      | | |       |  | |  |        |  |                       |   |         |    |   ..  |  |        ***..||  |                 |  ||      | |   ..PS00007..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |       | ..         | |    |      | | |       |  | |  |        |  |                       |   |         ^*****   ..  |  |           ..||  |                 |  ||      | |   ..PS00008..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    | |       **..*****************      | | |       |  | |  |        |  |                       |   |                  ..  |  |           ..||  |                 |  ||      | |   ..PS00107..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..******           ..||  |                 |  ||      | |   ..PS00108..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 *****      | |   ..alphabetamotif..          || |||   |  |              | ***** |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 |  |       | |   ..asxmotif..          || |||   |  |              | ***** |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |         ..         | |           | ***       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 |  |       | |   ..asxturn..          || |||   |  |              | ***|| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |         ..         | |           | |         |  | |  |        |  |                       |   |                  ..  |              ..||  |                 ****       | |   ..betaturn..          |****|   |  |              | ****| |  ****| | || |      ..    ****  |   |
search RasMol script viewer Motif-ligand binding stats  nest ..    ***         ..         ***           | |         |  | |  |        |  |                       |   |                  ..  |              ..||  |                            ***   ..nest..          |  ***   |  |              | ||  | |   |  | | || |      ..          |   |
search RasMol script viewer Motif-ligand binding stats  niche ..                ..                       ***         **** ****        ****                       |   |                  ..  |              ..|****                                  ..niche..          |    |   ****              ******* |   **** ******      ..          |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                ..                                                                               |   |                  ..  |              ..|                                      ..schellmannloop..          ******                             |   |                ..          |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                ..                                                                               *****                  ..  |              ..|                                      ..stmotif..                                             *****                ..          |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                ..                                                                                                      ..  |              ..|                                      ..ststaple..                                                                  ..          *****
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                ..                                                                                                      ..  *              ..*                                      ..REP00000..                                                                  ..               

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain F : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318F  ..                                                                                                                                                        ..CL ..                                                                                                         ..                
sec str:  ...........eeeee..........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh........hhhhhhhhhhhh..
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPA..GQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279  ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     ||||      |            | |       |                  | ||||  |                    |  |           |  ||         |    |   |   ||||||| ||       |     |..PS00004..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      | **^*  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**      |            | |       |                  | ^**|  |                    |  |           |  ||         |    |   |   ||||||| ||       |     |..PS00005..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |       |            | |       |                  |  | |  |                    ^***           ^***|         |    |   |   ||||||^***       |     |..PS00006..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | ^***| || | || |  ..  ^***|    |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |       |            | |       |                  |  | |  |                                   |   |         |    |   |   ||||||  |        ******^..PS00007..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |       |            | |       |                  |  | |  |                                   |   |         ^*****   |   ||||||  |               ..PS00008..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |       ************************                  |  | |  |                                   |   |                  |   ||||||  |               ..PS00107..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |                    | |                          |  | |  |                                   |   |                  ****^********               ..PS00108..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |                    | |                          |  | |  |                                   |   |                      ||||||                  ..alphabetamotif..||| |   |  |          *****      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  *****    |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |                    | |                          |  | |  |                                   |   |                      ***|||                  ..asxturn..||| |   |  |          |  |       | |    ***          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                    | |                          |  | ****                                   |   |                      ||||||                  ..betaturn..||| |   |  |          ****       | |                 |****|   |  |       ****      |  | |  ***** | || |  ..  ****|    **** 
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                    | |                          |  | |  |                                   |   |                      |****|                  ..nest..||| |   |  |                     ***                 |  ***   |  |                 |  | |   |  | | || |  ..  |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***                          **** ****                                   |   |                      | |  |                  ..niche..|****   ****                                         |    |   ****                 **** |   **** ******  ..  |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     |   |                      | |  |                  ..schellmannloop..| |                                                  ******                             |   |            ..  |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif..| |                                                                                     *****            ..  *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                | |  |                  ..stturn..***                                                                                                      ..                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                        ..                

Assembly 7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318F  ..                                                                                                                                                        ..CL ..                                                                                                           ..                
JMol viewer RasMol script viewer  CL 318A  ..                                                                                                                                                        ..CL ..                                                                                                           ..                
sec str:  ...........eeeeee.........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeeee..eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhh..........hhhhhhhhhhhh........hhhhhh.hhhhhh..........hhhhhhhhhhhhh.
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADL..GQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279    ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |            | |       |                | ||||||  |        |  |        |  |           |  |          |    |  ||| |||||||| ||       |     |..PS00004..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || **^*  || || |||| |    ..  |  |     || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |            | |       |                | ||^**|  |        |  |        |  |           |  |          |    |  ||| |||||||| ||       |     |..PS00005..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..  |  |     || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |||||     |            | |       |                | |||| |  |        |  |        ^***           ^***          |    |  ||| |||||||^***       |     |..PS00006..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || ^***| || |||| |    ..  ^***     || ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |||||     |            | |       |                | |||| |  |        |  |                                     |    |  ||| |||||||  |        ******^..PS00007..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |||||     |            | |       |                | |||| |  |        |  |                                     ^*****  ||| |||||||  |               ..PS00008..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |||||     ************************                | |||| |  |        |  |                                          |  ||| |||||||  |               ..PS00107..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     |||||                  | |                        | |||| |  |        |  |                                          |  |****^********               ..PS00108..||  |   |  |   | |    |  ||      | |          | |    || |||   |  |  |   | |  || | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                  | |                        *****| |  |        |  |                                          |  | | |||||||                  ..alphabetamotif..||  |   |  |   | |    *****      | |          | |    || |||   |  |  |   | ***** | ***** |  || |*****| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |||||                  | |                        | || | |  |        |  |                                          |  | | |||||||                  ..asxturn..||  |   |  |   ***    |  |       | |          ***    || |||   |  |  |   | |  |  | || || |  || || |||| |    ..           || ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|                  | |                        **** | |  |        |  |                                          |  | | |||||||                  ..betaturn..||  |   |  |          ****       | |                 |****|   |  |  |   | ****  | ****| |  ********|| |    ..           *****
search RasMol script viewer Motif-ligand binding stats  nest ..     *** |                  | |                          |  | |  |        |  |                                          |  | ***|****|                  ..nest..||  |   |  |                     ***                 |  ***   |  |  |   |       | ||  | |   |  | | || |    ..                
search RasMol script viewer Motif-ligand binding stats  niche ..      ****                  ***                          **** ****        ****                                          ****    | |  |                  ..niche..|****   ****                                         |    |   ****  |   |       ******* |   **** ******    ..                
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                                                | |  |                  ..schellmannloop..|                                                    ******         |   |               |   |              ..                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                                                | |  |                  ..stmotif..|                                                                   *****               *****              ..                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                          ..                

chain C : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318D  ..                 ..                                                                                                      ..                     ..                                         ..CL ..                                                                ..                
JMol viewer RasMol script viewer  CL 318C  ..                 ..                                                                               *                      ..                     ..                                         ..CL ..                                                                ..                
sec str:  ...........eeeeeee....eeeeee....eeeeeeeee.hhhhhhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.....hhhhhee.......ee..........hhhhhhh...hhhhhhhhhhhhhhhhhhhh......... ....hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh...........hhhhhhhhhhhhhh
sequence :  ..LPIMHDSDRYELVKDIG..VARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQ..DLKLENTLLDGSPAPRLKIAD..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFED... ..PKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLM..GQSIEEIMQIIAEATV
seq num:  ..12        22     ..34        44        54        64        74        84        94        104       114       124         ..140       150        ..179       189       199       209        ... ..223       233       243       253       263       273       283 ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    | ||||  |                    |  |           |  ||         |    |   ..| |  || ||       |   ..||  | | ||||   | |    |  ||      | |     ..PS00004..  |  ||     | |   |  |              | || **^*  ||  | |||| |     ..  |  ||    || ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     | ..      | |       |     |  || |||    | ^**|  |                    |  |           |  ||         |    |   ..| |  || ||       |   ..||  | | ||||   | |    |  ||      | |     ..PS00005..  |  ||     | |   |  |              | || || |  ||  | |||| |     ..  |  ||    || ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    |  | |  |                    ^***           ^***|         |    |   ..| |  |^***       |   ..||  | | ||||   | |    |  ||      | |     ..PS00006..  |  ||     | |   |  |              | || || ^***|  | |||| |     ..  ^***|    || ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     |||||     | ..      | |       |     |  || |||    |  | |  |                                   |   |         |    |   ..| |  |  |        ****..||  | | ||||   | |    |  ||      | |     ..PS00007..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |||||     | ..      | |       |     |  || |||    |  | |  |                                   |   |         ^*****   ..| |  |  |            ..||  | | ||||   | |    |  ||      | |     ..PS00008..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     |||||     **..*****************     |  || |||    |  | |  |                                   |   |                  ..| |  |  |            ..||  | | ||||   | |    |  ||      | |     ..PS00107..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     |||||       ..      | |             |  || |||    |  | |  |                                   |   |                  ..^********            ..||  | | ||||   | |    |  ||      | |     ..PS00108..  |  ||     | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****       ..      | |             |  |*****    |  | |  |                                   |   |                  ..| |  |               ..||  | *****|   | |    *****      | |     ..alphabetamotif..  *****     | |   |  |              | ***** |   |  *****| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  asxturn ..     |||||       ..      | |             |  || ||     |  | |  |                                   |   |                  ..| |  |               ..||  | | || |   ***    |  |       | |     ..asxturn..  |  |      | |   |  |              | || || |   |  | |||| |     ..  |   |    || ||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****|       ..      | |             |  *****     |  | |  |                                   |   |                  ..| |  |               ..||  | **** |          ****       | |     ..betaturn..  ****      | |   |  |              | ****| |   *******|| |     ..  |   |    *****
search RasMol script viewer Motif-ligand binding stats  nest ..     *** |       ..      | |             |  |         |  | |  |                                   |   |                  ..| |  |               ..||  |   |  |                     ***     ..nest..            ***   |  |              | ||  | |   |  | | || |     ..  |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..      ****       ..      ***             ****         **** ****                                   |   |                  ..| |  |               ..|****   ****                             ..niche..                  ****              ******* |   **** ******     ..  |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                 ..                                                                               *****                  ..| |  |               ..|                                        ..stmotif..                                            *****               ..  *****         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                 ..                                                                                                      ..* *  *               ..*                                        ..REP00000..                                                                ..                

chain D : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318D  ..                                                                                                                                                        ..CL ..                                                                                                         ..                      
JMol viewer RasMol script viewer  CL 318C  ..                                                                                                                                                        ..CL ..                                                                                                         ..                      
sec str:  ...........eeeeee.........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeeee..eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...........ee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhh.hhhhhh......hhhhh...hhhhhhhhhhhhhh
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPA..DESDQPGQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279  ..296       306         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |            | |       |                  | ||||  |                    |  |  |        |  ||         |    |  ||   | || || || | |   |     |..PS00004..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | || **^*  || || |||| |  ..|       |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |            | |       |                  | ^**|  |                    |  |  |        |  ||         |    |  ||   | || || || | |   |     |..PS00005..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..|       |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |||     |            | |       |                  |  | |  |                    ^***  |        ^***|         |    |  ||   | || |^*** | |   |     |..PS00006..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | ^***| || |||| |  ..*       ^***|    |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |||     |            | |       |                  |  | |  |                       |  |        |   |         |    |  ||   | || |  |  | |   ******^..PS00007..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |||     |            | |       |                  |  | |  |                       |  |        |   |         ^*****  ||   | || |  |  | |          ..PS00008..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |||     ************************                  |  | |  |                       |  |        |   |              |  ||   | || |  |  | |          ..PS00107..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |||                  | |                          |  | |  |                       |  |        |   |              |  |****^********  | |          ..PS00108..||  |   |  | |        |  ||      | |    | ||  |         | |   |  |              | ||  | |  || || |||| |  ..        |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                  | |                          |  | |  |                       |  |        |   |              |  |    | || |     | |          ..alphabetamotif..||  |   |  | |        *****      | |    | ||  |         | |   |  |              | ||  | |  || |*****| |  ..        *****    |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | ||                   | |                          |  | |  |                       |  |        |   |              |  |    | || |     | |          ..asxturn..||  |   |  | |        |  |       | |    ***|  |         | |   |  |              | ||  | |  || || |||| |  ..        |  |     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                   | |                          |  | |  |                       ****        |   |              |  |    | || |     | |          ..betaturn..|****   |  | |        ****       | |       ****         | |   |  |              | ||  | |  ********|| |  ..        ****     **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                    | |                          |  | |  |                                   |   |              |  |    | |***     | |          ..gammaturn..||  |   |  | |                   | |       |  |         | |   |  |              | ||  | |   |  | | || |  ..                      
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                    | |                          |  | |  |                                   |   |              |  |    | |  |     | |          ..nest..||  |   |  | |                   ***       |  |         ***   |  |              | ||  | |   |  | | || |  ..                      
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***                          **** ****                                   |   |              ****    | |  |     ***          ..niche..|****   ******                             ****               ****              ******* |   **** ******  ..                      
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif..|                                                                                       *****            ..                      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                        ..                      

chain F : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318F  ..                                                                                                                                                        ..CL ..                                                                                                         ..                
JMol viewer RasMol script viewer  CL 318A  ..                                                                                                                                                        ..CL ..                                                                                                         ..                
sec str:  ...........eeeee..........eeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ..hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh..hhhhh.hhhhhh.hhhhhh........hhhhhhhhhhhh..
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPA..GQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..179       189       199       209       219       229       239       249       259       269       279  ..302       312   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     ||||      |            | |       |                  | ||||  |                    |  |           |  ||         |    |   |   ||||||| ||       |     |..PS00004..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      | **^*  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**      |            | |       |                  | ^**|  |                    |  |           |  ||         |    |   |   ||||||| ||       |     |..PS00005..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |       |            | |       |                  |  | |  |                    ^***           ^***|         |    |   |   ||||||^***       |     |..PS00006..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | ^***| || | || |  ..  ^***|    |  | 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |       |            | |       |                  |  | |  |                                   |   |         |    |   |   ||||||  |        ******^..PS00007..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |       |            | |       |                  |  | |  |                                   |   |         ^*****   |   ||||||  |               ..PS00008..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |       ************************                  |  | |  |                                   |   |                  |   ||||||  |               ..PS00107..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |                    | |                          |  | |  |                                   |   |                  ****^********               ..PS00108..||| |   |  |          |  ||      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |                    | |                          |  | |  |                                   |   |                      ||||||                  ..alphabetamotif..||| |   |  |          *****      | |    | |          || |||   |  |       |  |      |  | |  || || | || |  ..  *****    |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | |                    | |                          |  | |  |                                   |   |                      ***|||                  ..asxturn..||| |   |  |          |  |       | |    ***          || |||   |  |       |  |      |  | |  || || | || |  ..  |  ||    |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |                    | |                          |  | ****                                   |   |                      ||||||                  ..betaturn..||| |   |  |          ****       | |                 |****|   |  |       ****      |  | |  ***** | || |  ..  ****|    **** 
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                    | |                          |  | |  |                                   |   |                      |****|                  ..nest..||| |   |  |                     ***                 |  ***   |  |                 |  | |   |  | | || |  ..  |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                            ***                          **** ****                                   |   |                      | |  |                  ..niche..|****   ****                                         |    |   ****                 **** |   **** ******  ..  |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     |   |                      | |  |                  ..schellmannloop..| |                                                  ******                             |   |            ..  |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif..| |                                                                                     *****            ..  *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                | |  |                  ..stturn..***                                                                                                      ..                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000..*                                                                                                        ..                

Assembly 8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318E  ..                                                                                                                                                        ..CL ..                                                                                                            ..                  
JMol viewer RasMol script viewer  CL 318B  ..                                                                                                                                                        ..CL ..                                                                                                            ..                  
sec str:  ...........eeeeeee.......eeeeee....eeeeeeeee.....hhhhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......hhhhhee.......ee......... ........hhhhhhh...hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhhhhhhhhh............hhhhhhhhhhhhh.
sequence :  ..LPIMHDSDRYELVKDIGAGNFGVARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQVAHRDLKLENTLLDGSPAPRLKIADFGY... ..GTPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADL..QPGQSIEEIMQIIAEATV
seq num:  ..12        22        32        42        52        62        72        82        92        102       112       122       132       142       152         ... ..178       188       198       208       218       228       238       248       258       268       278     ..300       310     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     |||||     |               | |    |  | |             | ||||  |        |  |        |  |  ||       |  ||         |    |  ||   ||||||| ||       |     |..PS00004.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || **^*  ||  | | || |    ..    |  ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |^**|     |               | |    |  | |             | ^**|  |        |  |        |  |  ||       |  ||         |    |  ||   ||||||| ||       |     |..PS00005.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |  ||  | | || |    ..    |  ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | |||     |               | |    |  | |             |  | |  |        |  |        ^***  ||       ^***|         |    |  ||   ||||||^***       |     |..PS00006.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || ^***|  | | || |    ..    ^***|         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     | |||     |               | |    |  | |             |  | |  |        |  |           |  ||       |   |         |    |  ||   ||||||  |        ******^..PS00007.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |||     |               | |    |  | |             |  | |  |        |  |           |  ||       |   |         ^*****  ||   ||||||  |               ..PS00008.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..     | |||     ************************  | |             |  | |  |        |  |           |  ||       |   |              |  ||   ||||||  |               ..PS00107.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..     | |||                     | |       | |             |  | |  |        |  |           |  ||       |   |              |  |****^********               ..PS00108.. ||| |          | |    |  ||      | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****                     | |       | |             |  | |  |        |  |           *****       |   |              |  |    ||||||                  ..alphabetamotif.. ||| |          | |    *****      | |       || |      || |||   |  |              | ***** |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..     | ||                      | |       | |             |  | |  |        |  |           |  |        |   |              |  |    ||||||                  ..asxturn.. ||| |          ***    |  |       | |       || |      || |||   |  |              | || || |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****                      | |       | |             |  | |  |        |  |           ****        |   |              |  |    ||****                  ..betaturn.. ||| |                 ****       | |       || |      |****|   |  |              | ****| |   **** | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     | |                       | |       ***             |  | |  |        |  |                       |   |              |  |    ||||||                  ..gammaturn.. ||| |                            | |       |***      |  | |   |  |              | ||  | |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  nest ..     ***                       ***                       |  | |  |        |  |                       |   |              |  |    |****|                  ..nest.. ||| |                            ***       |  |      |  ***   |  |              | ||  | |   |  | | || |    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                         **** ****        ****                       |   |              ****    | |  |                  ..niche.. |****                                      ****      |    |   ****              ******* |   **** ******    ..    |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                     |   |                      | |  |                  ..schellmannloop.. | |                                                  ******                             |   |              ..    |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                     *****                      | |  |                  ..stmotif.. | |                                                                                     *****              ..    *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                | |  |                  ..stturn.. ***                                                                                                        ..                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                * *  *                  ..REP00000.. *                                                                                                          ..                  

chain E : SERINE/THREONINE-PROTEIN KINASE SRK2E
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24343/searchPTHR24343_SF99PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchQ940H6
JMol viewer RasMol script viewer  CL 318E  ..                ..                                                                               *                      ..                 ..                                       ..CL ..                                                                  ..               
JMol viewer RasMol script viewer  CL 318B  ..                ..                                                                               |                      ..                 ..                                       ..CL ..                                                                  ..               
sec str:  ..........eeeeee......eeeee....eeeeeeeee.......hhhhhhhhhhh........eeeeee...eeeeeee.....hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.......ee.......ee....................hhhhhhhhhhhhhhhhhhh....... .....hhhhhhhhhhh...........hhhhhhhhhhhh........hhhhhh.hhhhhh..hhhhhh......hhhhhhhhhh.
sequence :  ..PIMHDSDRYELVKDIG..VARLMRDKQANELVAVKYIERGEKIDENVKREIINHRSLRHPNIVRFKEVILTPTHLAIVMEYASGGELFERICNAGRFSEDEARFFFQQLISGVSYAHAMQ..LENTLLDGSPAPRLKIA..TPAYIAPEVLLKKEYDGKVADVWSCGVTLYVMLVGAYPF... ..EPKNFRKTIHRILNVQYAIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLMN..GQSIEEIMQIIAEAT
seq num:  ..13        23    ..34        44        54        64        74        84        94        104       114       124         ..143       153    ..179       189       199       209      ... ..222       232       242       252       262       272       282   ..302       312  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    ||||      | ..         | |    |      | | |       | ||||  |        |  |        |  |           |  ||         |    |   ..  || ||       |  ..||  |                 |  ||      | |   ..PS00004..          || |||   |  |              | |||**^*  || || | || |      ..  | || |  |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |^**      | ..         | |    |      | | |       | ^**|  |        |  |        |  |           |  ||         |    |   ..  || ||       |  ..||  |                 |  ||      | |   ..PS00005..          || |||   |  |              | ||||| |  || || | || |      ..  | || |  |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |       | ..         | |    |      | | |       |  | |  |        |  |        ^***           ^***|         |    |   ..  |^***       |  ..||  |                 |  ||      | |   ..PS00006..          || |||   |  |              | ||||| ^***| || | || |      ..  ^*** |  |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    | |       | ..         | |    |      | | |       |  | |  |        |  |                       |   |         |    |   ..  |  |        ***..||  |                 |  ||      | |   ..PS00007..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |       | ..         | |    |      | | |       |  | |  |        |  |                       |   |         ^*****   ..  |  |           ..||  |                 |  ||      | |   ..PS00008..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..    | |       **..*****************      | | |       |  | |  |        |  |                       |   |                  ..  |  |           ..||  |                 |  ||      | |   ..PS00107..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..******           ..||  |                 |  ||      | |   ..PS00108..          || |||   |  |              | ||||| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 *****      | |   ..alphabetamotif..          || |||   |  |              | ***** |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..    | |         ..         | |           | | |       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 |  |       | |   ..asxmotif..          || |||   |  |              | ***** |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |         ..         | |           | ***       |  | |  |        |  |                       |   |                  ..  |              ..||  |                 |  |       | |   ..asxturn..          || |||   |  |              | ***|| |  || || | || |      ..    |  |  |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |         ..         | |           | |         |  | |  |        |  |                       |   |                  ..  |              ..||  |                 ****       | |   ..betaturn..          |****|   |  |              | ****| |  ****| | || |      ..    ****  |   |
search RasMol script viewer Motif-ligand binding stats  nest ..    ***         ..         ***           | |         |  | |  |        |  |                       |   |                  ..  |              ..||  |                            ***   ..nest..          |  ***   |  |              | ||  | |   |  | | || |      ..          |   |
search RasMol script viewer Motif-ligand binding stats  niche ..                ..                       ***         **** ****        ****                       |   |                  ..  |              ..|****                                  ..niche..          |    |   ****              ******* |   **** ******      ..          |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                ..                                                                               |   |                  ..  |              ..|                                      ..schellmannloop..          ******                             |   |                ..          |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                ..                                                                               *****                  ..  |              ..|                                      ..stmotif..                                             *****                ..          |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                ..                                                                                                      ..  |              ..|                                      ..ststaple..                                                                  ..          *****
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                ..                                                                                                      ..  *              ..*                                      ..REP00000..                                                                  ..               

   New search    3udb:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors