triangle PDBeMotif: 3u9j  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification protein binding    | release date: Wed, Oct 19, 2011
Title crystal structure of oxidized human fbxl5 hemerythrin like d
Authors P.LI
Method X-RAY DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MAPFPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVH
SDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : F-BOX/LRR-REPEAT PROTEIN 5
member of: GENE3D:searchG3DSA_1.20.120.520PANTHER:searchPTHR23125/searchPTHR23125_SF211PFAM:searchPF01814UniProt:searchQ9UKA1
JMol viewer RasMol script viewer  FE 201A  ..           *                                             *                                                                                                   
JMol viewer RasMol script viewer  FE 200A  ..           |                                          *  |                  *                                                 *                              
sec str:  ...hhhhh.hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | |                ||  |^***   |         | ||                   ||||     | | |   |  |  |  ||       |                            | |||||  ||             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | |                ||  ||  |   |         ^**|                   ||||     | | |   |  |  |  ||       |                            | |||||  ||             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | |                ||  ||  |   |         ^***                   ||||     | | |   ^***  |  ||       |                            | ||||^***|             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  | |                ||  ||  |   |                                ||||     | | |         |  |********^                            | |||||   |             
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  | |                ||  ||  |   |                                ||||     | | |         |  |                                     *****||   |             
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |                ||  ||  *****                                ||||     | | |         |  |                                     | || ||   |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  ***                ||  ||  |                                    ||||     | | |         |  |                                     | || ||   |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                  ||  ||  |                                    ||||     | | |         |  |                                     **** ||   |             
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                  ||  ||  |                                    ****     *****         |  |                                       |  ||   |             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                  |********                                     ***                   ****                                       ****|   |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        |   |                                                                                                              *****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****                                                                                                                                

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : F-BOX/LRR-REPEAT PROTEIN 5
member of: GENE3D:searchG3DSA_1.20.120.520PANTHER:searchPTHR23125/searchPTHR23125_SF211PFAM:searchPF01814UniProt:searchQ9UKA1
JMol viewer RasMol script viewer  FE 203B  ..           *                                             *                                                                                                   
JMol viewer RasMol script viewer  FE 202B  ..           |                                          *  *                  *                                                 *                              
sec str:  ...hhhhh.hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | |                ||  |^***   |         | ||               |   | |      | | |   |  |  |  ||       |       |   |                  |  ||  ||             
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | |                ||  ||  |   |         ^**|               |   | |      | | |   |  |  |  ||       |       |   |                  |  ||  ||             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | |                ||  ||  |   |         ^***               |   | |      | | |   ^***  |  ||       |       |   |                  |  |^***|             
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  | |                ||  ||  |   |                            |   | |      | | |         |  |********^       |   |                  |  ||   |             
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  | |                ||  ||  *****                            |   | |      | | |         |  |                |   |                  |  ||   |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  ***                ||  ||  |                                |   | |      | | |         |  |                |   |                  |  ||   |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                  ||  ||  |                                |   | |      | | |         |  |                |   |                  |  ||   |             
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                  ||  ||  |                                |   ***      *****         |  |                |   |                  |  ||   |             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                  |********                                |   |                      ****                |   |                  ****|   |             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                        |   |                                    |   |                                          |   |                      *****             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****                                    *****                                          *****                                        

   New search    3u9j:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors