triangle PDBeMotif: 3u71  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hydrolase    | release date: Thu, Oct 13, 2011
Title crystal structure analysis of south african wild type hiv-1 protease
Authors H.W.DIRR, I.A.ACHILONU, M.A.FERNANDES, P.NAICKER, S.FANUCCHI, Y.S
Method X-RAY DIFFRACTION (resolution: 2.72Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
PQITLWKRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPT
PVNIIGRNMLTQLGCTLNF
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HIV-1 PROTEASE
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PFAM:searchPF00077PROSITE PATTERNS:searchPS00141, PROSITE PROFILES:searchPS50175, SUPERFAMILY:searchSSF50630UniProt:searchQ994Q3
sec str:  ...........eeeeee..eeeeeee.......ee.........eeeeee....eeeeeeeeeeeeee..eeeeeeeee.....eeehhhhhh........
sequence :  ..PQITLWKRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF
seq num:  ..1         11        21        31        41        51        61        71        81        91       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | || | ^**       |  ||||||||||             |    |            || ||                |   | |||   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | || |           |  |^***|^***             |    |            || ||                |   | |||   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | || |           |  ||^*****|              ^*****            || ||                |   | |^*****
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | || |           |  |||| |  |                                |^***                |   | | |    
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..    | || |           ***^********                                |  |                 |   | | |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | || |              ***| |                                   |  |                 |   | | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | || |              || | |                                   ****                 |   | | |    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    | |***              || | |                                                        |   | | |    
search RasMol script viewer Motif-ligand binding stats  nest ..    | |                 || | |                                                        |   | ***    
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                 ******                                                        |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        ||                                                            *****        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                        **                                                                         

   New search    3u71:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors