triangle PDBeMotif: 3t6a  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Thu, Jul 28, 2011
Title structure of the c-terminal domain of bcar3
Authors H.ROBINSON, P.D.MACE, S.J.RIEDL
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Small molecules:    search POG POG binding statistics POG   search UNX UNX binding statistics UNX
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MGEFVTPLLETVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVS
SGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIM
LNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPV
KQAELLEHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  POG 834A  ..                                                                                                                                                                                          *                                                                                                                         
sec str:  .......hhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||                  || ||               |||| ||   |  ||| | |||  ||  |                |  || | | || ||                || | |       |  |  ||  |      |   |                  ||||       ^***       |  |  |      ||||  |           | |       | |    | || |  |   ||  |         |  | ||^***|           | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||                  || ||               |||| ||   |  ||| | |||  ||  |                |  || | | || ||                || | |       |  |  ||  |      |   |                  ||||                  |  |  |      ||||  |           ^**       ^**    | || |  |   ||  |         |  | ||| ^**           ^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||                  |^***               |||| ||   |  ||| ^***|  ||  |                |  || | | ^***|                ^*** |       |  |  |^***      |   |                  ||||                  ^***  |      ||||  |                            | || |  |   ||  |         |  | |||   |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||                  |  |                |||| ||   |  |^***** |  ||  |                |  || ^*****  |                 | | |       |  |  ||         |   |                  ||||                     |  |      ||||  |                            | || |  |   ||  |         ^*****||   |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                *****   | |   |                 | | |       |  *****         |   |                  ||||                     |  |      ||||  |                            | || |  |   ||  |            |  ||   |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                |  ||   | |   |                 | | |       |  |  |          |   |                  ||||                     |  |      ||||  |                            | || |  *****|  |            |  |*****                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                |  ||   | |   |                 | ***       |  |  |          |   |                  ||||                     |  |      ||||  |                            | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | **** | ||                  |  |                |||| ||   |  | | | | |  |****                ****|   | |   |                 | |         |  ****          |   |                  ||||                     |  |      |||****                            | || |       ****            |  |                       
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||                  |  |                **** ||   |  *** | | |  |                        |   | |   |                 ***         |  |             |   |                  ****                     |  |      ****                               | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ****                  ****                  ****|   |      | | ****                        |   | |   |                             ****             |   |                                           ****                                         ******       ****            ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |                                             *****      | |                             |   | *****                                              |   |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                        | |                             *****                                                    *****                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                        ***                                                                                                                                                                                                                                           

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  POG 834B  ..                                                                                                                                                                                                                                          **  *                                                                     
sec str:  ........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||    |  |          || ||               |||| |       ||| | |||  |  |                       |   ||||                 || |        || ||  ||  |   |  |   |                  ||||       ^*** | |   |  |  |      ||||  | |   |     | |       | |      |  |       |  |         |  | ||^***|           ||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||    |  |          || ||               |||| |       ||| | |||  |  |                       |   ||||                 || |        || ||  ||  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |     ^**       ^**      |  |       |  |         |  | ||  ^**           ^** |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||    |  |          |^***               |||| |       ||| ^***|  |  |                       |   ^***                 ^***        || ||  |^***   |  |   |                  ||||            | |   ^***  |      ||||  | |   |                        |  |       |  |         |  | ||                 |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||    |  |          |  |                |||| |       |^***** |  |  |                       ^*****|                   | |        || ||  ||  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |                        |  |       |  |         ^*****|                 |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||    |  |          |  |                |||| |       | |     |  |  |                           | |                   | |        *********  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |                        |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |  | | ||    |  |          |  |                |||| |       | |     *******                           | |                   | |        ********   |   |  |   |                  ||||            | |   |  ****      |||**** |   |                        |  |       ****            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||    |  |          |  |                **** |       ***     |  |                              | |                   ***         |  |      |   |  |   |                  ****            ***   |  |  |      ****    |   |                        |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ****    ****          ****                  ****               ****                              | |                               ****      |   |  |   |                                        *******              |   |                        ****       ****            ****                 ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |                                                                                              | |                                         |   |  |   |                                                             *****                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                                                              | |                                         *****  *****                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                              ***                                                                                                                                                                                                     

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
sec str:  ........................hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | |  ||  ||  |          || ||   |           |||| ||   |  ||| | |||  || ||                |  || | | || ||                || |         |  |  || ||      |   |                  ||||       ^***       |  |  |      ||||  | |   | |   | |       | |    | || |  |   ||  |         |  | ||^***|           | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | |  ||  ||  |          || ||   |           |||| ||   |  ||| | |||  || ||                |  || | | || ||                || |         |  |  || ||      |   |                  ||||                  |  |  |      ||||  | |   | |   ^**       ^**    | || |  |   ||  |         |  | ||  ^**           ^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | |  ||  ||  |          |^***   |           |||| ||   |  ||| ^***|  || ||                |  || | | ^***|                ^***         |  |  |^***      |   |                  ||||                  ^***  |      ||||  | |   | |   |                | || |  |   ||  |         |  | ||                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | |  ||  ||  |          |  ||   |           |||| ||   |  |^***** |  || ||                |  || ^*****  |                 | |         |  |  || |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  |   ||  |         ^*****|                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | |  ||  ||  |          |  ||   |           |||| ||   |  | |     |  || ||                *****   | |   |                 | |         |  ***** |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  |   ||  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | |  ||  ||  |          |  |*****           |||| ||   |  | |     |  || ||                |  ||   | |   |                 | |         |  |  |  |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  *****|  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |  | ****|  ||  |          |  |                |||| ||   |  | |     |  *****                ****|   | |   |                 | |         **********       |   |                  ||||                  |  |  |      |||**** |   | |   |                | ****       ****            |  |                       
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | |  ||  ||  |          |  |                **** ||   |  ***     |  |                        |   | |   |                 ***         |  |             |   |                  ****                  |  |  |      ****    |   | |   |                | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ************          ****                  ****|   |          ****                        |   | |   |                             ****             |   |                                        *******              |   | |   |                ******       ****            ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                           *****                                      |   | *****                                              |   |                                                             ***** |   |                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                      *****                                                    *****                                                                   *****                                                                        

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  UNX 841D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 840D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 839D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 838D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 837D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 836D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 835D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 834D  ..                                                                                                                                                                                                                                                                                                                    
sec str:  .......hhhhh............hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||| | |  |          || ||               |||| ||   |  ||| | |||  ||  |                      | | ||||                 || | |       |  |  ||  |   |  |   |                  ||||       ^***   |   |  |  |      ||||  | | |   |   | |       | |      |  |  |   ||  |         |  | ||^***|           ||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||| | |  |          || ||               |||| ||   |  ||| | |||  ||  |                      | | ||||                 || | |       |  |  ||  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   ^**       ^**      |  |  |   ||  |         |  | ||  ^**           ^** |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||| | |  |          |^***               |||| ||   |  ||| ^***|  ||  |                      | | ^***                 ^*** |       |  |  |^***   |  |   |                  ||||              |   ^***  |      ||||  | | |   |   |                  |  |  |   ||  |         |  | ||                 |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||| | |  |          |  |                |||| ||   |  |^***** |  ||  |                      ^*****|                   | | |       |  |  ||  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  |   ||  |         ^*****|                 |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | | |       |  *****  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  |   ||  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | | |       |  |  |   |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  *****|  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | ***       |  |  |   |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | **** ****| | |  |          |  |                |||| ||   |  | |     |  |****                      | | | |                   | |         |  ****   |   |  |   |                  ||||              |   |  ****      |||**** | |   |   |                  |  |       ****            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  |                          *** | |                   | |         |  |      |   |  |   |                  ||||              |   |  |  |      ||||    | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||| | |  |          |  |                **** ||   |  ***     |  |                              | |                   ***         |  |      |   |  |   |                  ****              |   |  |  |      ****    | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ******* ****          ****                  ****|   |          ****                              | |                               ****      |   |  |   |                                    |   |  ****              | |   |   |                  ****       ****            ****                 ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..           *****                                           *****                                            | |                                         |   |  |   |                                    |   |                    | |   |   |                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                                                              | |                                         *****  *****                                    *****                    | |   *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                              ***                                                                                                                  ***                                                                                

Assembly 5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  POG 834A  ..                                                                                                                                                                                          *                                                                                                                         
sec str:  .......hhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||                  || ||               |||| ||   |  ||| | |||  ||  |                |  || | | || ||                || | |       |  |  ||  |      |   |                  ||||       ^***       |  |  |      ||||  |           | |       | |    | || |  |   ||  |         |  | ||^***|           | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||                  || ||               |||| ||   |  ||| | |||  ||  |                |  || | | || ||                || | |       |  |  ||  |      |   |                  ||||                  |  |  |      ||||  |           ^**       ^**    | || |  |   ||  |         |  | ||| ^**           ^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||                  |^***               |||| ||   |  ||| ^***|  ||  |                |  || | | ^***|                ^*** |       |  |  |^***      |   |                  ||||                  ^***  |      ||||  |                            | || |  |   ||  |         |  | |||   |                  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||                  |  |                |||| ||   |  |^***** |  ||  |                |  || ^*****  |                 | | |       |  |  ||         |   |                  ||||                     |  |      ||||  |                            | || |  |   ||  |         ^*****||   |                  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                *****   | |   |                 | | |       |  *****         |   |                  ||||                     |  |      ||||  |                            | || |  |   ||  |            |  ||   |                  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                |  ||   | |   |                 | | |       |  |  |          |   |                  ||||                     |  |      ||||  |                            | || |  *****|  |            |  |*****                  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | |  | | ||                  |  |                |||| ||   |  | | | | |  ||  |                |  ||   | |   |                 | ***       |  |  |          |   |                  ||||                     |  |      ||||  |                            | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | **** | ||                  |  |                |||| ||   |  | | | | |  |****                ****|   | |   |                 | |         |  ****          |   |                  ||||                     |  |      |||****                            | || |       ****            |  |                       
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||                  |  |                **** ||   |  *** | | |  |                        |   | |   |                 ***         |  |             |   |                  ****                     |  |      ****                               | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ****                  ****                  ****|   |      | | ****                        |   | |   |                             ****             |   |                                           ****                                         ******       ****            ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |                                             *****      | |                             |   | *****                                              |   |                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                        | |                             *****                                                    *****                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                        ***                                                                                                                                                                                                                                           

chain B : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  POG 834B  ..                                                                                                                                                                                                                                          **  *                                                                     
sec str:  ........................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||    |  |          || ||               |||| |       ||| | |||  |  |                       |   ||||                 || |        || ||  ||  |   |  |   |                  ||||       ^*** | |   |  |  |      ||||  | |   |     | |       | |      |  |       |  |         |  | ||^***|           ||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||    |  |          || ||               |||| |       ||| | |||  |  |                       |   ||||                 || |        || ||  ||  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |     ^**       ^**      |  |       |  |         |  | ||  ^**           ^** |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||    |  |          |^***               |||| |       ||| ^***|  |  |                       |   ^***                 ^***        || ||  |^***   |  |   |                  ||||            | |   ^***  |      ||||  | |   |                        |  |       |  |         |  | ||                 |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||    |  |          |  |                |||| |       |^***** |  |  |                       ^*****|                   | |        || ||  ||  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |                        |  |       |  |         ^*****|                 |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||    |  |          |  |                |||| |       | |     |  |  |                           | |                   | |        *********  |   |  |   |                  ||||            | |   |  |  |      ||||  | |   |                        |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |  | | ||    |  |          |  |                |||| |       | |     *******                           | |                   | |        ********   |   |  |   |                  ||||            | |   |  ****      |||**** |   |                        |  |       ****            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||    |  |          |  |                **** |       ***     |  |                              | |                   ***         |  |      |   |  |   |                  ****            ***   |  |  |      ****    |   |                        |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ****    ****          ****                  ****               ****                              | |                               ****      |   |  |   |                                        *******              |   |                        ****       ****            ****                 ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..           | |                                                                                              | |                                         |   |  |   |                                                             *****                                                                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                                                              | |                                         *****  *****                                                                                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                              ***                                                                                                                                                                                                     

Assembly 6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
sec str:  ........................hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | |  ||  ||  |          || ||   |           |||| ||   |  ||| | |||  || ||                |  || | | || ||                || |         |  |  || ||      |   |                  ||||       ^***       |  |  |      ||||  | |   | |   | |       | |    | || |  |   ||  |         |  | ||^***|           | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | |  ||  ||  |          || ||   |           |||| ||   |  ||| | |||  || ||                |  || | | || ||                || |         |  |  || ||      |   |                  ||||                  |  |  |      ||||  | |   | |   ^**       ^**    | || |  |   ||  |         |  | ||  ^**           ^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | |  ||  ||  |          |^***   |           |||| ||   |  ||| ^***|  || ||                |  || | | ^***|                ^***         |  |  |^***      |   |                  ||||                  ^***  |      ||||  | |   | |   |                | || |  |   ||  |         |  | ||                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | |  ||  ||  |          |  ||   |           |||| ||   |  |^***** |  || ||                |  || ^*****  |                 | |         |  |  || |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  |   ||  |         ^*****|                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | |  ||  ||  |          |  ||   |           |||| ||   |  | |     |  || ||                *****   | |   |                 | |         |  ***** |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  |   ||  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | |  ||  ||  |          |  |*****           |||| ||   |  | |     |  || ||                |  ||   | |   |                 | |         |  |  |  |       |   |                  ||||                  |  |  |      ||||  | |   | |   |                | || |  *****|  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |  | ****|  ||  |          |  |                |||| ||   |  | |     |  *****                ****|   | |   |                 | |         **********       |   |                  ||||                  |  |  |      |||**** |   | |   |                | ****       ****            |  |                       
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | |  ||  ||  |          |  |                **** ||   |  ***     |  |                        |   | |   |                 ***         |  |             |   |                  ****                  |  |  |      ****    |   | |   |                | || |       |  |            |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ************          ****                  ****|   |          ****                        |   | |   |                             ****             |   |                                        *******              |   | |   |                ******       ****            ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                           *****                                      |   | *****                                              |   |                                                             ***** |   |                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                      *****                                                    *****                                                                   *****                                                                        

chain D : BREAST CANCER ANTI-ESTROGEN RESISTANCE PROTEIN 3
member of: GENE3D:searchG3DSA_1.10.840.10PANTHER:searchPTHR14247/searchPTHR14247_SF10PFAM:searchPF00617PROSITE PROFILES:searchPS50009, SMART:searchSM00147SUPERFAMILY:searchSSF48366UniProt:searchO75815
JMol viewer RasMol script viewer  UNX 841D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 840D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 839D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 838D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 837D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 836D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 835D  ..                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  UNX 834D  ..                                                                                                                                                                                                                                                                                                                    
sec str:  .......hhhhh............hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..........hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..
sequence :  ..TVSSFRPNEFESKFLPPENKPLETALLKRAKELFTNNDPKVIAQHVLSMDCRVARILGVSEEMRRNMGVSSGLELITLPHGHQLRLDIIERHNTMAIGIAVDILGCTGTLEDRAATLSKIIQVAVELKDSMGDLYSFSALMKALEMPQITRLEKTWTALRHQYTQTAILYEKQLKPFSKLLHEGRESTCVPPNNVSVPLLMPLVTLMERQAVTFEGTDMWEKNDQSCEIMLNHLATARFMAEAADSYRMNAERILAGFQPDEEMNEICKTEFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPP
seq num:  ..511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711       721       731       741       751       761       771       781       791       801       811     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |||||  | | ||| | |  |          || ||               |||| ||   |  ||| | |||  ||  |                      | | ||||                 || | |       |  |  ||  |   |  |   |                  ||||       ^***   |   |  |  |      ||||  | | |   |   | |       | |      |  |  |   ||  |         |  | ||^***|           ||| |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |^**|  | | ||| | |  |          || ||               |||| ||   |  ||| | |||  ||  |                      | | ||||                 || | |       |  |  ||  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   ^**       ^**      |  |  |   ||  |         |  | ||  ^**           ^** |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |  | | ||| | |  |          |^***               |||| ||   |  ||| ^***|  ||  |                      | | ^***                 ^*** |       |  |  |^***   |  |   |                  ||||              |   ^***  |      ||||  | | |   |   |                  |  |  |   ||  |         |  | ||                 |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |  | | ||| | |  |          |  |                |||| ||   |  |^***** |  ||  |                      ^*****|                   | | |       |  |  ||  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  |   ||  |         ^*****|                 |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | | |       |  *****  |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  |   ||  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | | |       |  |  |   |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |  *****|  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  ||  |                      | | | |                   | ***       |  |  |   |   |  |   |                  ||||              |   |  |  |      ||||  | | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | **** ****| | |  |          |  |                |||| ||   |  | |     |  |****                      | | | |                   | |         |  ****   |   |  |   |                  ||||              |   |  ****      |||**** | |   |   |                  |  |       ****            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | | |  | | ||| | |  |          |  |                |||| ||   |  | |     |  |                          *** | |                   | |         |  |      |   |  |   |                  ||||              |   |  |  |      ||||    | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..  | | |  | | ||| | |  |          |  |                **** ||   |  ***     |  |                              | |                   ***         |  |      |   |  |   |                  ****              |   |  |  |      ****    | |   |   |                  |  |       |  |            |  |                 |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  *** **** ******* ****          ****                  ****|   |          ****                              | |                               ****      |   |  |   |                                    |   |  ****              | |   |   |                  ****       ****            ****                 ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..           *****                                           *****                                            | |                                         |   |  |   |                                    |   |                    | |   |   |                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..           | |                                                                                              | |                                         *****  *****                                    *****                    | |   *****                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..           ***                                                                                              ***                                                                                                                  ***                                                                                

   New search    3t6a:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors