triangle PDBeMotif: 3t2d  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.11   4.1.2.13
Classification lyase, hydrolase    | release date: Fri, Jul 22, 2011
Title fructose-1,6-bisphosphate aldolase/phosphatase from thermopr neutrophilus, fbp-bound form
Authors G.FUCHS, J.DU, O.EINSLE, R.SAY, W.LUE
Method X-RAY DIFFRACTION (resolution: 1.36Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search P6F P6F binding statistics P6F
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEV
TDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDP
SMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVR
AQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDL
FDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKGAKVEESQHDL
EHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE/PHOSPHATASE
member of: PFAM:searchPF01950PIRSF:searchPIRSF015647PRODOM:searchPD014260SUPERFAMILY:searchSSF111249UniProt:searchB1YAL1
JMol viewer RasMol script viewer  P6F 412A  ..          *      *                                 *                                      *   *       ***                          **                                                                                                   **                              ***                             *                                                            *                                
JMol viewer RasMol script viewer  MG 411A  ..          |      |                                 |                                      |   |       |||                          ||                                                                                                   *|                              |||                             |                                                            |                                
JMol viewer RasMol script viewer  MG 410A  ..          |      |                                 |                                      |   |       |||                          ||                                                                                                   **                              |||                             |                                                            |                                
JMol viewer RasMol script viewer  MG 409A  ..          *      *                                 *                                      |   *       |||                          ||                                                                                                   ||                              |||                             |                                                            |                                
JMol viewer RasMol script viewer  MG 408A  ..          |      |                                 **                                     |   |       |||                          *|                                                                                                   |*                              |||                             |                                                            |                                
sec str:  ...eeeeeeeee...........hhhhhhhhhhhhhhhhhh....eeeeeee..eeeeeeee.....hhhhhhhhhhhhhhhhhhh...........................eeeeeeee....eeeeeeeee..hhhhhhhhhhhhhhh....hhhhhhhhhh..eeeeeee....eeeeeee..hhhhhhhhhh....eeeeeeee.....eeeee.....eee..eee.....eeeee......hhhhhhhh.....eeeehhhhheeee.ee....eee....eee....hhhhh..eeeeeeeeee..eeeeeee...hhhhhhhhhhhhhhhhhhhh.........hhhhh...hhhhhhhhh...hhhhhhhhhhhhhhhhhhh
sequence :  ..MRVTVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQKRGVIIDYFVYNVGDDISLLMTHTKGEDNKDIHGLAWETFKEVTDQIAKRFKLYGAGQDLLKDAFSGNIRGMGPQVAEMEFEERPSEPIIAFAADKTEPGAFNLPLYKMFADPFTTAGLVIDPSMHEGFIFEVLDVVEHKVYLLKTPEDAYSLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVLLVRAQSGLPAVGEVLEAFAHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGPKMTRFDGPPKVGALGFQLHEGYLEGGVDLFDDPAFDYVRQTAAQIADYIRRMGPFQPHRLPPEEMEYTALPKILAKVKPYPADQYEKDRKKYIEAVVKG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          | |  | ||  |  |          || ||||        | |       | || |   |     ^**| |      | | ||||| |  |  |   |||                    |  || || |     |  | |||  |  | |  |       | || |    ||  | |   |    ^**|         |||   |                                   |||||| |       | |         || | ||||      |  |            |  |     | | | |                  | ||  | || || || |  || ||                      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          | |  | ||  |  |          || ||||        | |       ^*** |   |     ^*** |      | | ||||| |  |  |   |||                    |  || || |     |  | |||  |  | ^***       | || |    |^*** |   |    |  |         |||   |                                   |||||| |       | |         || | ||||      ^***            |  |     | | | |                  | ||  | || || || |  || ||                      
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          | |  | ||  |  |          || ||||        | |         |  |   |      |   |      | | ||||| |  |  |   |||                    |  || || |     |  | |||  |  |            | || |    ******^   |    |  |         |||   |                                   |||||| |       | |         || | ||||      |  |            |  |     | | | |                  | ||  ********^| |  || ||                      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          | ^*****|  |  |          || ||||        | |         |  |   |      |   |      | | ||||| |  |  ^*****|                    |  || || |     |  | |||  |  |            | || |              ^*****  |         |^*****                                   |||||| |       | |         || | ||||      |  |            |  |     | | | |                  | ||  | || ||  | |  || ||                      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          | |  |  |  |  |          || ||||        | |         |  |   |      |   |      | | ||||| |  |      | |                    |  || || |     |  *****  |  |            | || |                   |  |         | |                                       |||||| |       | |         || | ||||      |  |            |  |     | | | |                  | ***** *****  | |  *****                      
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          | |  |  |  |  |          || ||||        | |         |  *****      |   |      | | ||||| |  |      | |                    |  || || |     |  *****  |  |            | || |                   |  |         | |                                       |||||| |       | |         || *****|      |  |            |  |     | | | |                  | ||  | || ||  | |  || ||                      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ***  |  |  |  |          || ||||        | |         |  |          |   |      | | ||||| |  |      | |                    |  || || |     |  ***|   |  |            ***| |                   |  |         | |                                       |||||| |       | |         || ***| |      |  |            |  |     *** ***                  | ||  | || ||  | |  || ||                      
search RasMol script viewer Motif-ligand binding stats  betabulge ..               |  |  |  |          || ||||        | |         |  |          |   |      | | ||||| |  |      | |                    |  || || |     |  |  |   |  |               | |                   |  |         | |                                       |||||| |       | |         ** |  | |      |  |            |  |                              | ||  | || ||  | |  || ||                      
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..               |  |  |  |          || ||||        | |         |  |          |   |      | | ||||| |  |      | |                    |  || || |     |  |  |   |  |               | |                   |  |         | |                                       |||||| |       | |            ******      |  |            |  |                              | ||  | || ||  | |  || ||                      
search RasMol script viewer Motif-ligand binding stats  betaturn ..               ****  ****          |****||        | |         |  |          |   |      | | ****| |  |      | |                    |  |******     |  ****   |  |               | |                   |  |         | |                                       *****| |       | |               | |      ****            ****                              | ||  | ****|  | |  ****|                      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                   |  ||||        | |         |  |          |   |      | |  |||| |  |      | |                    |  |           |  |      |  |               | |                   |  |         | |                                         |  ***       | |               | |                                                        | ||  |  |  |  | |   |  |                      
search RasMol script viewer Motif-ligand binding stats  nest ..                                   |  ****        | |         |  |          |   |      ***  |*** |  |      ***                    |  |           |  |      |  |               ***                   |  |         ***                                         |  |         ***               ***                                                        | ||  |  |  |  | |   |  |                      
search RasMol script viewer Motif-ligand binding stats  niche ..                                   |    |         ***         ****          |   |        **** *******                             ****           ****      ****                                     ****                                                     ****                                                                                      *******  ****  | |   ****                      
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                   ******                                   |   |                                                                                                                                                                                                                                                                                     | |                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                            *****                                                                                                                                                                                                                                                                                     | |                             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                                                                                                                                                                                                                                      ***                             

   New search    3t2d:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors