triangle PDBeMotif: 3spj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification metal transport    | release date: Fri, Jul 1, 2011
Title apo inward rectifier potassium channel kir2.2 i223l mutant
Authors R.MACKINNON, S.B.HANSEN, X.TAO
Method X-RAY DIFFRACTION (resolution: 3.31Å)
PDBe Citation   
Small molecules:    search K K binding statistics K
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INWARD-RECTIFIER K+ CHANNEL KIR2.2
member of: CATH:search1.10.287.70/search2.60.40.1400GENE3D:searchG3DSA_1.10.287.70/searchG3DSA_2.60.40.1400PANTHER:searchPTHR11767/searchPTHR11767_SF14PFAM:searchPF01007/searchPF08466PRINTS:searchKIR22CHANNEL/searchKIRCHANNELSUPERFAMILY:searchSSF81296/searchSSF81324UniProt:searchF1NHE9
JMol viewer RasMol script viewer  K 505A  ..                  ..                                                                                                                                                                                                                                                                                                               
JMol viewer RasMol script viewer  K 504A  ..                  ..                                                                         *                                                                                                                                                                                                                                     
JMol viewer RasMol script viewer  K 503A  ..                  ..                                                                         **                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  K 502A  ..                  ..                                                                         |**                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  K 501A  ..                  ..                                                                         ||**                                                                                                                                                                                                                                  
sec str:  .............eeee.....hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........ee...hhhhhhhhhhhhhh.......ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........eee...eeeeee..eeeeeeeeee.....eeeeeeeeeeeeeee.....eeeeeeeee..hhhhh..ee.....eeeeee..........hhhhhh....eeeeeeeeee.....eeeeeeeee...eee.eee...eeee..eeeee......eee.......hhhhhhhhhhhhhhh
sequence :  ..NRFVKKNGQCNVEFTNMD..MFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENKFLLSNS
seq num:  ..43        53      ..70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | || |  |  |.. | || ||  |  ||                       |||| | | | ^**  |  |        | | | ||||||||                    |   |   |  | ||                                | | |              | | ||||        ||||||||||             |  | |  ||  |   | |       |    | |        || ||                       | |   |  ^**|^**||     |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | || |  ^***.. | ^***|  |  ||                       |||| | | | ||   |  |        | | | ||||||||                    |   |   |  | ||                                | | |              | | ||||        ||||||||||             |  | |  |^***   | |       |    | |        || ||                       | |   |  || |^***|     |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | || |      .. |  |  |  |  ||                       |||| | | | ||   |  |        | | | ||||||||                    |   |   |  | ||                                | | |              *******^        ||||||||||             |  | |  |       | |       |    | |        || ||                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | || |      .. |  |  |  |  ||                       |||| | ^*****   |  |        | | | ||||||||                    |   |   ^*****|                                | | |                | |||         ||||||||||             |  | |  |       | |       ^***** |        || ||                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | || |      .. |  |  |  *****                       |||| |   | ||   |  |        | | | ||||||||                    |   |      |  |                                | | |                | |||         ||||||||||             |  | |  |       | |            | |        || ||                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  asxturn ..      | || |      .. |  |  |  |  |                        |||| |   ***|   |  |        | | | ||||||||                    |   |      |  |                                | | |                | |||         ***|||||||             |  | |  |       | |            | |        || ||                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | || |      .. |  |  |  |  |                        |||| |   |  |   |  |        | | | ||||||||                    |   |      |  |                                | | |                *****          |||||||||             |  | |  |       | |            | |        || ||                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | || |      .. *******  ****                        ||****   |  |   |  |        | | | ||||||||                    |   |      ****                                | | |                ****|          ||****|||             **** |  |       | |            | |        ****|                       | |   ****| ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  nest ..      ***| |      ..                                      ****     |  |   |  |        | | | ********                    |   |                                          | | |                  ***          ********|             |  | |  |       | |            ***         |  |                       | |   |  || ||   |     |   |
search RasMol script viewer Motif-ligand binding stats  niche ..         ***      ..                                               ****   ****        | | | | |                         |   |                                          *****                                    ****             **** ****       ***            | |         ****                       ***   *******|   |     |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  ..                                                                  | | | | |                         |   |                                                                                                                                   | |                                                 *****     |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  ..                                                                  ******* |                         *****                                                                                                                                   | |                                                           *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                  ..                                                                        ***                                                                                                                                                                 ***                                                                

   New search    3spj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors