triangle PDBeMotif: 3s8w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein receptor    | release date: Tue, May 31, 2011
Title d2 domain of human ifnar2
Authors C.THOMAS, K.C.GARCIA
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search CL CL binding statistics CL
Modified residues:  search MSE MSE binding statistics MSE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
ADPDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYC
VSVYLEHSDEQAVIKSPLKCTLLPP
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : INTERFERON ALPHA/BETA RECEPTOR 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR20859/searchPTHR20859_SF23PFAM:searchPF09294SUPERFAMILY:searchSSF49265UniProt:searchP48551
JMol viewer RasMol script viewer  CL 1A  ..                      ..                   ..       *               ..             
sec str:  .......eeeeee....eeeeee....eeeeee....eeee.......eeeee.......eeeeeeee..........eeee...
sequence :  ..SFEPPEFEIVGFTNHINVMVKF..SLVIEEQSEGIVKKHKPEI..NFTYIIDKLIPNTNYCVSVYLEH..VIKSPLKCTLLPP
seq num:  ..106       116         ..140       150      ..165       175          ..193          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  |       ..       |  |        ..^***     |  |          ..             
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |       ..       |  |        ..|        |  |          ..             
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |       ..       |  |        ..*        |  |          ..             
search RasMol script viewer Motif-ligand binding stats  niche ..           ****       ..       ****        ..         ****          ..             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : INTERFERON ALPHA/BETA RECEPTOR 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR20859/searchPTHR20859_SF23PFAM:searchPF09294SUPERFAMILY:searchSSF49265UniProt:searchP48551
sec str:  ......eeeeee....eeeeee....eeeeeeee..eeeee.......eeeee.......eeeeeeeee............eeeee...
sequence :  ..FEPPEFEIVGFTNHINVMVKF..LSLVIEEQSEGIVKKHKPEI..NFTYIIDKLIPNTNYCVSVYLEHSD..QAVIKSPLKCTLLPP
seq num:  ..107       117        ..139       149       ..165       175       185  ..191       201  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..          |  |       ..                    ..^***     |  |            ..               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          |  |       ..                    ..|        |  |            ..               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |  |       ..                    ..*        |  |            ..               
search RasMol script viewer Motif-ligand binding stats  niche ..          ****       ..                    ..         ****            ..               

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : INTERFERON ALPHA/BETA RECEPTOR 2
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR20859/searchPTHR20859_SF23PFAM:searchPF09294SUPERFAMILY:searchSSF49265UniProt:searchP48551
JMol viewer RasMol script viewer  CL 1C  ..                       ..                  *                                                  
sec str:  .......eeeeee....eeeeeee......eeeeeeee..eeeee..ee.....eeeeeee.......eeeeeeeee............eeee...
sequence :  ..SFEPPEFEIVGFTNHINVMVKFP..FDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPP
seq num:  ..106       116          ..137       147       157       167       177       187       197      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           |  |        ..          |  |         |^***^***     |  |          | ||              
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           |  |        ..          |  |         |    |        |  |          | ||              
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           |  |        ..          |  |         ^*****        |  |          | ||              
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |        ..          ****                       |  |          | ||              
search RasMol script viewer Motif-ligand binding stats  niche ..           ****        ..                                     ****          ****              
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ..                                                   ***               

   New search    3s8w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors