triangle PDBeMotif: 3rze  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.1.17
Classification hydrolase    | release date: Wed, May 11, 2011
Title structure of the human histamine h1 receptor in complex with
Authors G.W.HAN, G.WINTE, GPCR NETWORK (GPCR), H.TSUJIMOTO, JOINT CENTER FOR INNOVATIVE MEMBRANE PR, M.SHIROISHI, R.ABAGYAN, R.STEVENS, S.WEYAND, T.KOBAYASHI, T.SHIMAMURA, TECHNOLOGIES (JCIMPT), V.CHEREZOV, V.KATRITCH, W.LIU
Method X-RAY DIFFRACTION (resolution: 3.10Å)
PDBe Citation   
Small molecules:    search OLC OLC binding statistics OLC   search 5EH 5EH binding statistics 5EH   search D7V D7V binding statistics D7V   search PO4 PO4 binding statistics PO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
TTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPL
CLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDK
CETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSL
NAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLR
MLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCK
NCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRSGENLYFQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HISTAMINE H1 RECEPTOR, LYSOZYME CHIMERA
member of: GENE3D:searchG3DSA_1.20.1070.10PANTHER:searchPTHR24249/searchPTHR24249_SF244PFAM:searchPF00001PRINTS:searchGPCRRHODOPSN/searchHISTAMINEH1RPROSITE PATTERNS:searchPS00237, PROSITE PROFILES:searchPS50262, SUPERFAMILY:searchSSF81321UniProt:searchP35367
JMol viewer RasMol script viewer  OLC 1205A  ..                                                                                                                                            ..                                                                                                  * *                                                                                                                                                                                           
JMol viewer RasMol script viewer  PO4 1204A  ..                                                                                                                                            ..                                                                                                  | |                                                                                      ****                                                                                                 
JMol viewer RasMol script viewer  PO4 1203A  ..                                                                                                                                            ..                                                                                                  | |                    *   *                                                             ||||                                                                                                 
JMol viewer RasMol script viewer  PO4 1202A  ..                                                                                                                                            ..    *           *                                                                                 | |                    |   |                                                             ||||                                          *   *              *                                   
JMol viewer RasMol script viewer  D7V 1201A  ..                                                                               **  **  *                                          *         ..    |           |      *                                                                          | |                    |   |                                                             ||||                                       *  **  *              |       *                           
JMol viewer RasMol script viewer  5EH 1200A  ..                                                                               **  **  |                                          *         ..    |           |      |                                                                          | |                    |   |                                                             ||||                                   *   *  **  *              |       *                           
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhh.hhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhheeeeeee.....eeeee.ee.....hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhh............................................................................................................
sequence :  ..MPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNH..RREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLHMNRERKAAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHI
seq num:  ..28        38        48        58        68        78        88        98        108       118       128       138       148       158       ..175       185       195       205       215       1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      1115      1125      1135      1145      1155      408       418       428       438       448       458       468       478     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   ||  |||   |        | | ||||  |         || ||| ||        |  | |               |   ||               |      ||||   |   |             |  |   ..|      |||| |  |   |                        | || |           |     | |             |   | |  |  | | | |  |  |              ||  ||     |  || |       |  ||          | ||| |||      || ||   |           | |||| | || | |                               | | |   |  ||    | ^***|  | || | |   | |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||  |||   |        | | ^**|  |         || ||| ||        |  | |               |   ||               |      ||||   |   |             |  |   ..*      |||| |  |   |                        | || |           |     | |             |   | |  |  | | | |  |  |              ||  ||     |  || |       |  ||          ^**|| |||      || ||   |           ^**||| | || | |                               | | |   |  ||    |   | |  | || | |   ^**     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||  |||   |        | | || |  |         ^***|| ||        |  | |               |   ||               |      ||||   |   |             |  |   ..       |||| |  |   |                        | || |           |     | |             |   | ^***  | | | |  ^***              ||  ||     |  || |       |  ||             || |||      || ||   |              ||| | || | |                               | | |   |  ||    |   | |  | || | |   |       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   ||  |||   |        | | || |  |          |  || ||        |  | |               |   ||               |      ||||   |   |             |  |   ..       |||| |  |   |                        | || |           ********^             |   |       | | | |                    ||  ||     |  || |       |  ||             || |||      || ||   |              ||| | || | |                               | | |   |  ||    |   | |  | || | |   |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||  |||   |        | | || |  |          |  || ||        |  | |               |   ||               |      ||||   |   |             |  |   ..       |||| |  |   |                        | || |                 | |             |   |       | | | |                    ^*****     |  || |       |  ||             || |||      || ||   |              |^*****| | |                               | | |   |  ||    |   | |  | || | |   |       
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..   ||  |||   |        | | || |  |          |  || ||        |  | |               |   ||               |      ||||   |   |             |  |   ..       |||| |  |   |                        | || |                 | |             |   |       | | | |                     |  |      |  || |       |  ||             || |||      || ||   |              | | |  | | |                               | | |   ********************** | |   |       
search RasMol script viewer Motif-ligand binding stats  G_PROTEIN_RECEP_F1_1 ..   ||  |||   |        | | || |  |          |  || ||        |  | |               |   |*****************      ||||   |   |             |  |   ..       |||| |  |   |                        | || |                 | |             |   |       | | | |                     |  |      |  || |       |  ||             || |||      || ||   |              | | |  | | |                               | | |   |  ||    |   | |  | |  | |   |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||  |||   |        | | || |  |          ********        |  | |               |   |                       ||||   |   |             |  |   ..       |||| |  |   |                        | || |                 | |             |   |       | | | |                     |  |      |  || |       *****             || |||      || ||   |              | | |  | | |                               | | |   *****    |   | |  | |  | |   |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..   ||  |||   |        | | || |  |          |  |  |         |  | |               |   |                       ||||   |   |             |  |   ..       |||| |  |   |                        | |***                 | |             |   |       | | | |                     |  |      |  |***       |  |              || |||      || ||   |              | | |  | | |                               | | |   |  |     |   | |  | |  | |   |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ||  |||   |        | | || |  |          *******         |  | |               |   |                       ||||   |   |             |  |   ..       ||****  |   |                        | |                    | |             |   |       | | | |                     |  |      ****          ****              |****|      *****   |              | | |  | | |                               | | |   ****     |   | **** |  | |   |       
search RasMol script viewer Motif-ligand binding stats  nest ..   ||  |||   |        | | || |  |                          |  | |               |   |                       ****   |   |             |  |   ..       **** |  |   |                        ***                    ***             |   |       *** ***                     |  |      |  |                            |  ***       |  |   |              *** |  | ***                               *****            |   |      |  | |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..   ||  |||   |        | **** ****                          ******               |   |                              |   |             ****   ..         ****  |   |                                                               |   |           | |                     ****      ****                            |    |       ****   |                | ****                                                    |   |      **** |   |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   ||  |||   |        |   |                                                     |   |                              |   |                    ..               |   |                                                               |   |           | |                                                               ******          |   |                | |                                                       |   |           |   |       
search RasMol script viewer Motif-ligand binding stats  stmotif ..   ||  |||   |        |   |                                                     |   |                              |   |                    ..               |   |                                                               *****           | |                                                                               *****                | |                                                       |   |           |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..   ***********        *****                                                     *****                              *****                    ..               *****                                                                               | |                                                                                                    | |                                                       *****           *****       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                            ..                                                                                                   ***                                                                                                    ***                                                                                   

   New search    3rze:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors