triangle PDBeMotif: 3rt0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.3.16
Classification hydrolase/hydrolase inhibitor    | release date: Mon, May 2, 2011
Title crystal structure of pyl10-hab1 complex in the absence of ab acid (aba)
Authors C.YAN, J.WANG, L.WANG, N.YAN, P.YIN, Q.HAO, W.LI
Method X-RAY DIFFRACTION (resolution: 2.11Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVA
DYCRDRLHFALAEEIERIKDELSKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVV
ALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIP
EPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSK
DNISIIVIDLKAQRKFKTRT
Chains C,D sequence:
MNGDETKKVESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLK
SGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALI
QSNLNSLADVTERLQAESMEKKI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN PHOSPHATASE 2C 16
member of: CATH:search3.60.40.10GENE3D:searchG3DSA_3.60.40.10PANTHER:searchPTHR13832/searchPTHR13832_SF269PFAM:searchPF00481PROSITE PATTERNS:searchPS01032, PROSITE PROFILES:searchPS51746, SMART:searchSM00331/searchSM00332SUPERFAMILY:searchSSF81606UniProt:searchQ9CAJ0
JMol viewer RasMol script viewer  MG 512A  ..                                                 ..           *                                                                                                                                                                                            *                                                           *                  
sec str:  ..hhhhh.....eeeeee........eeeeeeeeeeeee.hhh...........eeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh....ee......ee.........ee.eeeeee...eeeeeee...eeeeee..eeee........hhhhhhhhhhh...eee...eee.........ee.hhhh.......eeeeee....eeeeeeehhhhhh..hhhhhhhhhhhhhhhhhhhh...hhhhh....hhhhhhhhhhhhhhhhhh.....eeeeeee..........
sequence :  ..SVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMS..THLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELSKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTR
seq num:  ..180       190       200       210       220      ..232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||            |^***|||      |||  || ||||  ||  ..      | |  | ||                           ||||| |           |   |     ||||   |  ||||      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||   | |        | |||         |  |                |  |    |  || |    |          || |||  ^***   | |        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||            | || |||      |||  || ||||  ||  ..      | |  | ||                           |**^* |           |   |     ||||   |  ||||      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||   | |        | |||         |  |                |  |    |  || |    |          || |||   |     | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||            | || |||      |||  || ||||  ||  ..      | |  | ||                           ^** | |           |   |     ||||   |  |^**      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||   | |        | |||         |  |                |  |    |  || |    |          || |||   |     | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|            | |^***|      |||  || ||||  ||  ..      | |  | ||                               | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |   |  || |||           | |    ^***||||   | |        ^***|         |  |                |  |    |  || |    |          || |||   |     | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |            | |  | |      |||  || ||||  ||  ..      | |  | ||                               | |           |   |     ||||   |  | |       |  |         |  |      | |                 *******^  || |||           | |       |||||   | |        | |||         |  |                |  |    |  || |    |          || |||   |     | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |            | |  | |      |||  || ||||  |^**..      | ^*****|                               | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |      || |||           | |       |||||   | |        | |||         |  |                |  |    |  || ^*****          || |^*****     | |        
search RasMol script viewer Motif-ligand binding stats  PPM_1 .. |  |            | |  | |      |||  || ||||  |   ..      *****^***                               | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |      || |||           | |       |||||   | |        | |||         |  |                |  |    |  || |               || |||         | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |            | |  | |      |||  |*****|  |   ..                                              | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |      || |||           | |       *****   | |        | |||         |  |                |  |    |  || |               || |||         | |        
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |            | |  | |      |**  || || |  |   ..                                              | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |      || |||           | |       |||||   | |        | |||         |  |                |  |    |  || |               || |||         | |        
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |            | |  | |      | |  ***** |  |   ..                                              | |           |   |     ||||   |  | |       |  |         |  |      | |                 |  |      |****|           | |       *****   | |        ****|         |  |                |  |    |  || |               |****|         | |        
search RasMol script viewer Motif-ligand binding stats  nest .. |  |            | |  | |      ***        |  |   ..                                              | |           |   |     ****   |  | |       |  |         |  |      | |                 |  |      |  ***           ***       *** |   | |        | |||         |  |                |  |    |  |***               |  ***         | |        
search RasMol script viewer Motif-ligand binding stats  niche .. ****            ***  ***      ***        ****   ..                                              ***           |   |            ******       ****         ****      ***                 ****      |    |                      ****   ***        ****|         ****                ****    ****                  |    |         ***        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                 ..                                                            |   |               | |                                                            ******                                        | | |                                                           ******                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                 ..                                                            |   |               | |                                                                                                          *****                                                                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 ..                                                            *****               | |                                                                                                          | |                                                                                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                 ..                                                                                ***                                                                                                          ***                                                                                       

chain C : ABSCISIC ACID RECEPTOR PYL10
member of: GENE3D:searchG3DSA_3.30.530.20PANTHER:searchPTHR31213/searchPTHR31213_SF4PFAM:searchPF10604SUPERFAMILY:searchSSF55961UniProt:searchQ8H1R0
sec str:  ..hhhhhhhhhh.......eeeeeeeeee..hhhhhhhhhh...hhhhh...eeeeee.........eeeeee.......eeeeeeeeee....eeeeeeeee....eeeeeeeeeeeeee..eeeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..VESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQSNLNSLADVTERLQAESME
seq num:  ..9         19        29        39        49        59        69        79        89        99        109       119       129       139       149       159       169         
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |  |  |                           ||| |   ||  |     |  | |  | ||   | ||   |     || | || |           | ^***                         |  ||  |              || | | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |  |  |                           ||| |   ||  |     |  | |  ^**|   | ||   |     || | || |           |  |                           |  ||  |              || | ^**       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |  |  |                           ||| |   ||  |     |  | |  ^***   | ||   |     || | || |           |  |                           |  |^***              ^*** |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..****^  |  |                           ********^|  |     |  | |  |      | ||   |     || | || |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |  |                           ||| |    |  |     |  | |  |      | ^*****     || | || |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       |  |                           ||| |    |  |     ^*** |  |      |  |         || | || |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |  |                           ||| |    |  |          |  |      |  |         || ***| |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..       |  |                           ||| |    |  |          |  |      |  |         **    | |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |  |                           |****    |  |          ****      |  |               | |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |  |                           ***      |  |          |  |      |  |               | |           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  nest ..       |  |                                    |  |          |  |      |  |               ***           |  |                           |  |                   |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..       ****                                    ****          ****      ****                             ****                           ****                   |   |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                                              *****         

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PROTEIN PHOSPHATASE 2C 16
member of: CATH:search3.60.40.10GENE3D:searchG3DSA_3.60.40.10PANTHER:searchPTHR13832/searchPTHR13832_SF269PFAM:searchPF00481PROSITE PATTERNS:searchPS01032, PROSITE PROFILES:searchPS51746, SMART:searchSM00331/searchSM00332SUPERFAMILY:searchSSF81606UniProt:searchQ9CAJ0
JMol viewer RasMol script viewer  MG 512B  ..                                          ..             *                             ..                                                                                                                                                          *                                                                          
sec str:  ..hhhhh.....eeeeee........eeeeeeeeeeeee.hhh......eeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh....eee..eeeee.........ee.eeeeee...eeeeeee...eeeeee..eeee........hhhhhhhhhhh...eee...eee.........ee.hhhh.......eeeeee....eeeeeeehhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhh....hhhhhhhhhhhhhhhhhh.....eeeeeee......
sequence :  ..SVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLM..SLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDE..TGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRK
seq num:  ..180       190       200       210         ..230       240       250       260          ..278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||             ^***|||      |||  |  |  .. |      | |  | ||                     |  | ..|         |   |   |     ||||   |  || |      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||  || |        | |||         |  |                        |  || |    |          || |||  ^***   | |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|| ||               | |||      |||  |  |  .. |      | |  | ||                     |  | ..*         |   |   |     ||||   |  || |      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||  || |        | |||         |  |                        |  || |    |          || |||   |     | |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||               | |||      |||  |  |  .. |      | |  | ||                     |  | ..          |   |   |     ||||   |  |^**      |  |         |  |      | |                 |  |   |  || |||           | |    |  |||||  || |        | |||         |  |                        |  || |    |          || |||   |     | |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|               ^***|      |||  |  |  .. |      | |  | ||                     |  | ..          |   |   |     ||||   |  |         |  |         |  |      | |                 |  |   |  || |||           | |    ^***||||  || |        ^***|         |  |                        |  || |    |          || |||   |     | |    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|| ||                 | |      |||  |  |  .. |      | |  | ||                     |  | ..          |   |   |     ||||   |  |         |  |         |  |      | |                 *******^  || |||           | |       |||||  || |        | |||         |  |                        |  || |    |          || |||   |     | |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||                 | |      |||  |  |  ..**      | ^*****|                     |  | ..          |   |   |     ||||   |  |         |  |         |  |      | |                 |  |      || |||           | |       |||||  || |        | |||         |  |                        |  || ^*****          || |^*****     | |    
search RasMol script viewer Motif-ligand binding stats  PPM_1 ..|| ||                 | |      |||  |  |  ..        *****^***                     |  | ..          |   |   |     ||||   |  |         |  |         |  |      | |                 |  |      || |||           | |       |||||  || |        | |||         |  |                        |  || |               || |||         | |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..|| ||                 | |      |**  |  |  ..                                      |  | ..          |   |   |     ||||   |  |         |  |         |  |      | |                 |  |      || |||           | |       |||||  || |        | |||         |  |                        |  || |               || |||         | |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|                 | |      | |  ****  ..                                      **** ..          |   |   |     ||||   ****         |  |         |  |      | |                 |  |      |****|           | |       ****|  || |        ****|         |  |                        |  || |               |****|         | |    
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                 | |      ***        ..                                           ..          |   |   |     ****   |  |         |  |         |  |      | |                 |  |      |  ***           ***       *** |  || |        | |||         |  |                        |  |***               |  ***         | |    
search RasMol script viewer Motif-ligand binding stats  niche .. ****                 ***                 ..                                           ..          |   |   |            ****         ****         ****      ***                 ****      |    |                      **********        ****|         ****                        ****                  |    |         ***    
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                          ..                                           ..          |   |   |                                                                              ******                                        | | |                                                           ******                
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                          ..                                           ..          |   |   |                                                                                                                            *****                                                                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                          ..                                           ..          *********                                                                                                                            | |                                                                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          ..                                           ..                                                                                                                                               ***                                                                                   

chain D : ABSCISIC ACID RECEPTOR PYL10
member of: GENE3D:searchG3DSA_3.30.530.20PANTHER:searchPTHR31213/searchPTHR31213_SF4PFAM:searchPF10604SUPERFAMILY:searchSSF55961UniProt:searchQ8H1R0
sec str:  .........eeeeeeeeee..hhhhhhhhhh...hhhhh...eeeeee.........eeeeee.......eeeeeeeeee....eeeeeeeee.......eeeeeeeee......eeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..KKHH..SQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETI..KTGTLAIESFVVDVPEGNTKEETCFFVEALIQSNLNSLADVTERLQAESME
seq num:  ..15  ..25        35        45        55        65        75        85        95        105       115          ..130       140       150       160       170        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    ..                      ||| | | ||  |     || | |  | ||   | ||   |     || | || |     ||| | | ^***         ..              |  ||  ||     |   |   || | | | |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    ..                      ||| | | ||  |     || | |  ^**|   | ||   |     || | || |     ||| | |  |           ..              |  ||  ||     |   |   || | ^** |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ..                      ||| | | ||  |     || | |  ^***   | ||   |     || | || |     ||| | |  |           ..              |  |^***|     |   |   ^*** |   |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    ..                      ********^|  |     || | |  |      | ||   |     || | || |     ||| | |  |           ..              |  ||   |     |   |    |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    ..                      ||| | |  |  |     || | |  |      | ^*****     || | || |     ||| | |  |           ..              |  ||   |     |   |    |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    ..                      ||| | |  |  |     ^*** |  |      |  |         || | || |     ||| | |  |           ..              |  ||   |     |   |    |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    ..                      ||| | |  |  |      | | |  |      |  |         || ***| |     ||| | |  |           ..              |  ||   |     |   |    |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..    ..                      ||| | |  |  |      | | |  |      |  |         **    | |     **| | |  |           ..              |  ||   |     |   |    |   |   |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    ..                      |**** |  |  |      | | ****      |  |               | |       | | |  |           ..              ****|   |     |   |    |   |   ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ..                      ***   |  |  |      | | |  |      |  |               | |       | | |  |           ..              |  ||   |     |   |    |   |         
search RasMol script viewer Motif-ligand binding stats  nest ..    ..                            |  |  |      | | |  |      |  |               ***       | | |  |           ..              |  ||   |     |   |    |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..    ..                            *******      *** ****      ****                         ********           ..              ****|   |     |   |    |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..    ..                                                                                                       ..                  *****     |   |    |   |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..    ..                                                                                                       ..                            *****    *****         

   New search    3rt0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors