triangle PDBeMotif: 3rnt  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.27.3
Classification hydrolase(endoribonuclease)    | release date: Wed, May 31, 1989
Title crystal structure of guanosine-free ribonuclease t1, complexed with vanadate(v), suggests conformational change upon substrate binding
Authors D.KOSTREWA, H.-W.CHOE, U.HEINEMANN, W.SAENGER
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search VO4 VO4 binding statistics VO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVF
NENNQLAGVITHTGASGNNFVECT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEASE T1
member of: CATH:search3.10.450.30GENE3D:searchG3DSA_3.10.450.30PFAM:searchPF00545PIRSF:searchPIRSF037430SUPERFAMILY:searchSSF53933UniProt:searchP00651
JMol viewer RasMol script viewer  VO4 106A  ..                                     * *                 *                  *              *     * *    
JMol viewer RasMol script viewer  CA 105A  ..              *                      | |                 |                  |              |     | |    
sec str:  .....eee..eee.hhhhhhhhhhhhhhhhh..........eee.............eeeee...............eeeeee....eeeeee.........ee..
sequence :  ..ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  ||  | |  ^***| |          | |    | | |     | ||        |    ^***   | | |||    | |||     ||||||| |     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ||  | |  | | | |          | |    | | |     | ||        |     | |   ^*****|    | |||     |||^*****     
search RasMol script viewer Motif-ligand binding stats  betabulge ..  **  | |  | | | |          | |    | | |     | ||        |     | |     | | |    | |||     ||| ||| |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..      | |  | | | |          | |    | | |     | ||        |     | |     | | |    *****     ||| ||| |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |  | | | |          | |    | | |     | ||        |     | |     | | |    ****|     ||| |****     
search RasMol script viewer Motif-ligand binding stats  nest ..      | |  | | | |          ***    *** |     ***|        |     ***     | | |      ***     ||| ||| |     
search RasMol script viewer Motif-ligand binding stats  niche ..      ***  | | | |                     |        |        |     | |     | ***              *****|***     
search RasMol script viewer Motif-ligand binding stats  stmotif ..           ***** |                     |        |        |     | |     | |                 |   |        
search RasMol script viewer Motif-ligand binding stats  ststaple ..             *****                     |        |        |     | |     | |                 |   |        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                       |        |        |     ***     ***                 |   |        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                       *        *        *                                 *   *        

   New search    3rnt:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML