triangle PDBeMotif: 3rk3  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification membrane protein/exocytosis    | release date: Sun, Apr 17, 2011
Title truncated snare complex with complexin
Authors D.KUEMMEL, K.M.REINISCH
Method X-RAY DIFFRACTION (resolution: 3.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
GPLGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
Chain B sequence:
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKK
Chain C sequence:
GSHMMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLG
W
Chain D sequence:
GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML
Chain E sequence:
GPLGSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VAMP2
member of: GENE3D:searchG3DSA_1.10.3840.10PANTHER:searchPTHR21136/searchPTHR21136_SF36PFAM:searchPF00957PIRSF:searchPIRSF005409PRINTS:searchSYNAPTOBREVNPROSITE PATTERNS:searchPS00417, PROSITE PROFILES:searchPS50892, SUPERFAMILY:searchSSF58038UniProt:searchP63027
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKL
seq num:  ..27        37        47        57  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**||| |                         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  ***** |                         
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****  |                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..    *****                         

chain B : SYNTAXIN 1A
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19957/searchPTHR19957_SF84PFAM:searchPF05739PROSITE PATTERNS:searchPS00914, PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF47661UniProt:searchP32851
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
seq num:  ..189       199       209       219       229       239         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|   || | ||  ||| | ^**|             |  | |  ||  |          | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   ^*** ||  ||| | ^***             ^*** |  ||  |          | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****   ||  ||| | |||                   |  ||  |          | |
search RasMol script viewer Motif-ligand binding stats  SYNTAXIN ..         ****************************************          | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          *****| *****                   *****             | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..          **** | ****                    ****              | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               |   |                                       ***
search RasMol script viewer Motif-ligand binding stats  ststaple ..               *****                                          

chain C : SNAP25
member of: CATH:search1.20.5.110GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19305/searchPTHR19305_SF5PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF58038UniProt:searchP60880
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..ELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEA
seq num:  ..10        20        30        40        50        60        70   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  ||   |  ^**    |   |  | | |||      |  ||          |  ||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****   |         |   |  | *****      *****          *****
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|   |         |   |  | ****       ****           **** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..           *****         *****  *****                            

chain D : SNAP25
member of: GENE3D:searchG3DSA_1.20.5.110PANTHER:searchPTHR19305/searchPTHR19305_SF5PFAM:searchPF00835/searchPF05739PROSITE PROFILES:searchPS50192, SMART:searchSM00397SUPERFAMILY:searchSSF58038UniProt:searchP60880
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..GSARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML
seq num:  ..139       149       159       169       179       189       199  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||         | |||| |||      |   |            ||^*** |  |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ^**|         | |||| |||      |   |            |^**|  |  |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***         | |||| |||      |   |            |   ^***  |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..              | ^*****||      |   |            |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..              **********      |   |            |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..              **** ****       |   |            |   |     |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                              *****            *****     *****   

chain E : COMPLEXIN-1
member of: GENE3D:searchG3DSA_1.20.5.580PANTHER:searchPTHR16705/searchPTHR16705_SF3PFAM:searchPF05835SUPERFAMILY:searchSSF58038UniProt:searchO14810
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..GSKLPDAAKKFEEAQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIK
seq num:  ..24        34        44        54        64        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****   *****                            | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****    ****                             | | 
search RasMol script viewer Motif-ligand binding stats  nest ..                                              *** 

   New search    3rk3:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors