triangle PDBeMotif: 3rfm  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
Download original PDB file
Download xml file
Download structure factors file
Classification signaling protein    | release date: Wed, Apr 6, 2011
Title thermostabilised adenosine a2a receptor in complex with caff
Authors A.S.DORE, B.TEHAN, C.G.TATE, E., F.H.MARSHALL, F.MAGNANI, I.NG, J.C.ERREY, K.BENNETT, K.HOLLENSTEIN, M.CONGREVE, M.WEIR, N.ROBERTSON
Method X-RAY DIFFRACTION (resolution: 3.60Å)
PDBe Citation   
Small molecules:    search CFF CFF binding statistics CFF
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAH
HHHHHHHHH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ADENOSINE RECEPTOR A2A
JMol viewer RasMol script viewer  CFF 330A  ..                                                                                                                                               ..          *        *                                                                       *   *                *   *                               
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............eeehhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFIACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQP..GCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRS
seq num:  ..7         17        27        37        47        57        67        77        87        97        107       117       127       137          ..158       168       178       188       198       208       218       228       238       248       258       268       278       288       298     
search RasMol script viewer Motif-ligand binding stats  PS00001 ..|   |                      | |  ^***                                            |  ||  |           |       |    |        |   | |   |  | | |  | ..|    |   | ||||                                      |  |   | |         |   |                        |  |            |   |  |||  |||  | ||  |||     
search RasMol script viewer Motif-ligand binding stats  PS00005 ..|   |                      | |  |                                               |  ||  |           |       |    |        |   | |   |  | | |  | ..|    |   | ||||                                      |  |   | |         |   |                        |  |            |   |  |||  |||  | ||  ^**     
search RasMol script viewer Motif-ligand binding stats  PS00008 ..|   |                      | |  |                                               |  ||  |           |       ^*****        |   | |   |  | | |  | ..^*****   | ||||                                      |  |   | |         |   |                        |  |            |   |  |||  |||  | ||  ||      
search RasMol script viewer Motif-ligand binding stats  PS00237 ..|   |                      | |  |                                               |  *****************                     |   | |   |  | | |  | ..         | ||||                                      |  |   | |         |   |                        |  |            |   |  |||  |||  | ||  ||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|   |                      | |  |                                               |  ||  |                                 |   | |   |  | | |  | ..         *****|                                      |  |   | |         |   |                        |  |            |   **********|  | |*****      
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   |                      ***  |                                               |  ||  |                                 |   | |   |  | | |  | ..         | || |                                      |  |   | |         |   |                        |  |            |   |  | |  | |  | ||  |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |                        |  |                                               |  ||  |                                 |   | |   **** | |  | ..         **** |                                      |  |   | |         |   |                        |  |            |   **** **** |  | |****       
search RasMol script viewer Motif-ligand binding stats  nest ..|   |                        |  |                                               |  ||  |                                 |   | |   |  *** |  | ..           |  |                                      |  |   ***         |   |                        |  |            |   |         |  | |   |       
search RasMol script viewer Motif-ligand binding stats  niche ..|   |                        ****                                               |  ||  |                                 |   | |   |      **** ..           ****                                      ****               |   |                        ****            |   |         **** |   |       
search RasMol script viewer Motif-ligand binding stats  ststaple ..*****                                                                           ********                                 ***** *****           ..                                                                        *****                                        *****              *****       

   New search    3rfm:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  PDB  |  XML  |  Structure factors