triangle PDBeMotif: 3qpv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.105   3.1.3.46
Classification transferase,hydrolase    | release date: Mon, Feb 14, 2011
Title pfkfb3 trapped in a phospho-enzyme intermediate state
Authors D.NEAU, M.C.CAVALIER, S.G.KIM, Y.H.LEE
Method X-RAY DIFFRACTION (resolution: 2.50Å)
PDBe Citation   
Small molecules:    search F6P F6P binding statistics F6P   search ADP ADP binding statistics ADP   search PHS PHS binding statistics PHS   search FDP FDP binding statistics FDP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVK
QYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTV
VASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKA
LNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFL
DKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHAT
member of: CATH:search3.40.50.1240/search3.40.50.300GENE3D:searchG3DSA_3.40.50.1240/searchG3DSA_3.40.50.300PANTHER:searchPTHR10606/searchPTHR10606_SF12PFAM:searchPF00300/searchPF01591PIRSF:searchPIRSF000709PRINTS:search6PFRUCTKNASEPROSITE PATTERNS:searchPS00175, SMART:searchSM00855SUPERFAMILY:searchSSF52540/searchSSF53254UniProt:searchQ16875
JMol viewer RasMol script viewer  F6P 720A  ..                  ..                                                                                                                                                                                                                                        **                                                        *          *             *   *          *                         *   *                                                      ..F6P ..       
JMol viewer RasMol script viewer  ADP 700A  ..                  ..           *******                                                                                                      *      *   *   **                                                *                         *                    ||                                                        |          |             |   |          |                         |   |                               *                      ..ADP ..       
JMol viewer RasMol script viewer  PHS 710A  ..                  ..           |||||||                                                                                                      |      |   |   ||                                                |                         |        **     *    ||                                                        |          |             |   |          |                        **   |                               |                      ..PHS ..       
JMol viewer RasMol script viewer  FDP 524A  ..                  ..           |||||||                   ***  *            *          *                          ***    *                   |      |   |   |*                    *   *                       |                         |        ||     |    ||                                                        |          |             |   |          |                        ||   |                               |                      ..FDP ..       
sec str:  ....ee......ee...........eeeeee.....hhhhhhhhhhhhhhhh...eeeeehhhhhhhhh....hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh...eeeee....hhhhhhhhhhhhhhh..eeeeeeee..hhhhhhhhhhhhh..hhhhh..hhhhhhhhhhhhhhhhhh...............eeeee....eeeee...hhhhhhhhhhhh........eeeee...hhhhhh.........hhhhhhhhhhhhhhhhhh.....eeee..hhhhhhhhhh.....ee.hhhh...hhhhh..hhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhh..eeeeehhhhhhhhhhhhh.....hhhhh.....eeeeeeee..eeeeeeee................. ..hhhhh..
sequence :  ..ELTQSRVQKIWVPVDHRP..NSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQLKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKLTPVAYGCRVESIYLNVESVCTHRERSE... ..NPLMRRN
seq num:  ..3         13      ..32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442  ... ..453    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |        ..         |  |||||  |||||   | |||     |  ||    | |  ||| ||  |   |                    |||   |   |^***| |      |  |||      |  || |         | || |    | |       | ||  |  |        |  |     | ||||                || ||| |     | ||  | |||||| |    || |  |           | |       | | |   ||  | |     |  || ||| || ||  ||  |  |    |   |  |      |  ||   |  ||  |  |       |           | ||  || ||  |  |                 | |   |||||   ..PS00001..|| || |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |        ..         |  |||||  |**^*   | |||     |  ||    | |  ||| ||  |   |                    |||   |   |||||| |      |  |||      |  || |         | || |    | |       **^*  |  |        |  |     | ||||                || ||| |     | ||  | |||||| |    || |  |           | |       | | |   ||  | |     |  || ||| || ||  ||  |  |    |   |  |      |  ||   |  ||  |  |       |           | ||  || ||  |  |                 | |   |||||   ..PS00004..|| |**^
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |        ..         |  |||||  ^**     | |||     |  ||    | |  ||| ||  |   |                    |||   |   ||^**| |      |  |||      |  || |         | || |    | |          |  |  |        |  |     | ||||                || ||| |     | ||  | |||||| |    |^**  |           | |       | | |   ||  | |     |  || ||| || ||  ||  |  |    |   |  |      |  ||   |  ||  |  |       |           | ||  || ||  |  |                 | |   |^**|   ..PS00005..|| ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |        ..         |  |||||  |       | |||     |  ||    | |  ||| ||  |   |                    |||   |   ||^*** |      |  |||      ^***| |         | ^***    | |          ^***  |        |  |     | ||||                || ||| |     | ||  | |||||| |    |  |  |           | |       | | |   ||  | |     |  || ||| || |^***|  ^***    |   |  |      ^***|   |  ||  |  |       |           | |^***| ||  |  |                 | |   |^***   ..PS00006..|| ||  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | |        ..         |  |||||  |       | |||     |  ||    | |  ||| ||  |   |                    |||   |   ||||   |      |  |||          | |         |  | |    | |             |  |        |  |     | ||||                || ||| |     | ||  | |||||| |    |  |  |           | |       | | |   ||  | |     |  || ||| || ||  ||  |       *******^      |  ||   |  ||  |  |       |           | *******^|  |  |                 | |   | |     ..PS00007..|| ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |        ..         |  |||||  |       | |||     |  ||    | |  ||| ||  |   |                    |^*****   ||||   |      |  |||          | |         |  | |    | |             |  |        |  |     | ||||                || ||| |     | ||  | |||||| ^*****  |  |           | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      |  ||   |  ||  |  |       |           | ||   |  |  |  |                 | |   | |     ..PS00008..|| ||  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |        ..         |  |||||  |       | |||     |  ||    | |  ||| ||  |   |                    | |       ||||   |      |  |||          | |         |  | |    | |             |  |        |  |     | ^***                || ||| |     | ||  | ||||||         ^***           | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      |  ||   |  ||  |  |       |           | ||   |  |  |  |                 | |   | |     ..PS00009..|| ||  
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..       | |        ..         ********  |       | |||     |  ||    | |  ||| ||  |   |                    | |       ||||   |      |  |||          | |         |  | |    | |             |  |        |  |     |  |||                || ||| |     | ||  | ||||||                        | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      |  ||   |  ||  |  |       |           | ||   |  |  |  |                 | |   | |     ..PS00017..|| ||  
search RasMol script viewer Motif-ligand binding stats  PG_MUTASE ..       | |        ..            |||||  |       | |||     |  ||    | |  ||| ||  |   |                    | |       ||||   |      |  |||          | |         |  | |    | |             |  |        |  |     |  |||                || ||| |     ***^******||||                        | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      |  ||   |  ||  |  |       |           | ||   |  |  |  |                 | |   | |     ..PS00175..|| ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |        ..            |||||  |       | |||     *****    | |  ||| ||  |   |                    | |       ||||   |      *****|          | |         |  | |    | |             |  |        |  |     |  |||                *****| |       ||  | ||||||                        | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      *****   *****  |  |       |           | ||   |  |  |  |                 | |   | |     ..alphabetamotif..|| ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | |        ..            |||||  |       | |||     |  |     | |  ||| ||  *****                    | |       ||||   |      |  | |          | |         |  | |    | |             |  |        |  |     |  |||                || ||| |       ||  *****|||                        | |       | | |   ||  | |     |  || ||| || ||  ||  |           |  |      |  ||   |  |   |  |       |           | ||   |  |  |  |                 | |   | |     ..asxmotif..|| ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | |        ..            |||||  |       | |||     |  |     | |  ||| ||                           | |       ||||   |      |  | |          ***         |  | |    ***             |  |        |  |     |  |||                || ||| |       ||    || |||                        | |       | | |   ||  | |     |  || *** || ||  ||  |           |  |      |  ||   |  |   |  |       |           | ||   |  |  |  |                 | |   | |     ..asxturn..|| ||  
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |        ..            |||||  |       | |||     |  |     | |  ||| ||                           | |       ||||   |      |  | |                      |  | |                    |  |        |  |     |  |**                || ||| |       ||    || |||                        | |       | | |   ||  | |     |  ||  || || ||  ||  |           |  |      |  ||   |  |   |  |       |           | ||   |  |  |  |                 | |   | |     ..betabulge..|| ||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |        ..            |||||  |       | |||     |  |     | |  ||| ||                           | |       ||||   |      |  | |                      |  | |                    |  |        |  |     ******                || ||| |       ||    || |||                        | |       | | |   ||  | |     |  ||  || || ||  ||  |           |  |      |  ||   |  |   |  |       |           | ||   |  |  |  |                 | |   | |     ..betabulgeloop..|| ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |        ..            |||||  |       ****|     ****     | |  |****|                           | |       ||||   |      **** |                      |  | |                    |  |        ****        | |                ****|| |       ||    |****|                        | |       | | |   |**** |     ****|  ****| ||  ||  |           |  |      ****|   ****   |  |       |           | ||   |  |  |  |                 | |   | |     ..betaturn..****|  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       | |        ..            |||||  |         | |              ***  | |  |                           | |       ||||   |         | |                      |  | |                    |  |        |  |        | |                 |  || |       ||    || | |                        | |       | | |   |   | |     |  ||   | || ||  ||  |           |  |      |   |          |  |       |           | ||   |  |  |  |                 | |   | |     ..gammaturn.. |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..       ***        ..            *****  |         ***                   | |  |                           ***       ****   |         ***                      |  | |                    |  |        |  |        ***                 |  || |       ||    || ***                        ***       | | |   |   ***     |  ||   | || ||  ||  |           |  |      |   |          |  |       |           ***|   |  |  |  |                 ***   | |     ..nest.. |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..                  ..               |   |                               | ****                                      ***   |                                  **** |                    ****        ****                            *******       ||    ||   |                                  *** |   |           ****|   ******|  ||  |           ****      |   |          ****       |              |   ****  ****                       ***     ..niche.. ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                  ..               |   |                               | |                                           |   |                                     | |                                                                              ||    ******                                  | | |   |               |         |  ||  |                     |   |                     |              |   |                                        ..schellmannloop..       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  ..               |   |                               | |                                           *****                                     | |                                                                              ||     |                                      | | |   |               |         *****  |                     *****                     |              *****                                        ..stmotif..       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  ..               *****                               | |                                                                                     | |                                                                              ||     |                                      | | *****               |            *****                                               |                                                           ..ststaple..       
search RasMol script viewer Motif-ligand binding stats  stturn ..                  ..                                                   ***                                                                                     ***                                                                              ||     |                                      ***                     |                                                                |                                                           ..stturn..       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  ..                                                                                                                                                                                                                            **     *                                                              *                                                                *                                                           ..REP00000..       

   New search    3qpv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors