triangle PDBeMotif: 3qow  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.1.1.43
Classification transferase    | release date: Fri, Feb 11, 2011
Title dot1l structure in complex with sam
Authors L.JIN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search SAM SAM binding statistics SAM   search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MHHHHHHSSGMGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFES
MQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDE
IKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRE
RIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPV
SYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPS
PSKARKKKLNKKGRKMAGRKRGRPKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HISTONE-LYSINE N-METHYLTRANSFERASE
member of: CATH:search3.40.50.150GENE3D:searchG3DSA_3.40.50.150PANTHER:searchPTHR21451/searchPTHR21451_SF0PFAM:searchPF08123PIRSF:searchPIRSF037123PROSITE PROFILES:searchPS51569, SMART:searchSM00384SUPERFAMILY:searchSSF53335UniProt:searchQ8TEK3
JMol viewer RasMol script viewer  SO4 419A  ..                                                       ..                                                                                                                                                                         *                      *  **                                            ..SO4 ..                          
JMol viewer RasMol script viewer  SO4 418A  ..                                                       ..                                                                                                                                               *         *               |                      |  ||                                            ..SO4 ..                          
JMol viewer RasMol script viewer  SAM 417A  ..                                                       ..                                                                         * *****                     * **   **                **               |         |       ***     |         * *   *      |  ||                                            ..SAM ..                          
sec str:  ....eeee........eeee....eee..eehhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.hhhhhhh............hhhhhhhhhhhh......eeeee....hhhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhhhhhhhh.....eeeee....hhhhhhhhhh..eeee.....hhhhhhhhhhhhh......eeee.................hhhh.eeeee........ ..........eeeee.hhhhhhhhhhh.
sequence :  ..KLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENY..LIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK... ..WTGKPVSYYLHTIDRTILENYFSSLK
seq num:  ..4         14        24        34        44        54   ..60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290        ... ..305       315       325   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||   |        | |||   |   | |  |  |          ..    |  |   |               |  || |         |   |      ||^*** |       |  | ||   || | |   |  |  | |||    |||||||   ||  |      | | ||                   | ||       | | ||     || ^***    |  |           |  ||  |   | |   |  |  | |^*** |  |         ..PS00001.. | |         | |  |  | |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |||   |        | |||   |   | |  |  |          ..    |  |   |               |  || |         |   |      ||  || |       |  | ||   || | |   |  |  | |||    |||||||   ||  |      | | ||                   | ||       | | ||     ||  |      |  |           |  ||  |   | |   |  |  | ||  | |  |         ..PS00004.. | |         | |  |  | |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||   |        | |||   |   ^**  |  |          ..    |  |   |               |  || |         |   |      ||  || |       |  | ||   || | |   |  |  | |||    |||||||   ||  |      | | ||                   | ||       | | ||     ||  |      |  |           |  ||  |   ^**   |  |  | ||  | |  |         ..PS00005.. ^**         | |  |  | ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||   |        | |||   |        |  |          ..    |  |   |               |  || |         |   |      ||  ^***       |  | ||   ^*** |   |  |  ^***|    |||||||   ||  |      | | ||                   | ||       | | ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..PS00006.. | |         | ^***  |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |^*****        | |||   |        |  |          ..    |  |   |               |  || |         |   |      ||  ||         |  | ||    |   |   |  |  | |||    ^*****|   ||  |      ^*****                   | ||       | | ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..PS00008.. | |         | |     |  | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | | |            | |||   |        |  |          ..    |  |   |               |  || |         |   |      ||  ||         |  | ||    |   |   |  |  | |||    |||||||   ||  |        | |                    ^***       | | ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..PS00009.. | |         | |     |  | 
search RasMol script viewer Motif-ligand binding stats  RGD ..       | | |            | |||   |        |  |          ..    |  |   |               |  || |         |   |      ||  ||         |  | ||    |   |   |  |  | |||    |||||||   ||  |        | |                    | |        *** ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..PS00016.. | |         | |     |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | | |            | |||   |        |  |          ..    |  |   |               ***** |         |   |      |*****         |  | ||    |   |   |  |  | |||    |||||||   ||  |        | |                    | |          | ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..alphabetamotif.. | |         | |     |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       | | |            | ||*****        |  |          ..    |  |   |               |  || |         |   |      ||  |          |  | ||    |   |   |  |  | |||    |||||||   ||  |        | |                    | |          | ||     ||  |      |  |           |  ||  |         |  |  | ||  | |  |         ..asxmotif.. | |         | |     |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..       | | |            ***|             |  |          ..    |  |   |               |  || |         |   |      ||  |          |  | ||    |   |   |  |  | |||    |||||||   ||  |        | |                    | |          ***|     ||  |      |  |           |  ||  |         |  |  ***|  | |  |         ..asxturn.. | |         ***     |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | | |            |  |             |  |          ..    ****   |               ****| |         |   |      |****          |  | ||    |   |   |  |  ****|    |****||   ||  |        | |                    | |          |  |     ||  |      ****           ****|  |         |  |     **** |  |         ..betaturn.. | |                 **** 
search RasMol script viewer Motif-ligand binding stats  nest ..       | ***            |  |             |  |          ..    |  |   |                   | |         |   |      |   |          |  | ||    |   |   |  |  | |||    *******   ||  |        | |                    ***          |  |     ||  |                     |  ||  |         |  |     |  | |  |         ..nest.. ***                      
search RasMol script viewer Motif-ligand binding stats  niche ..       | |              ****             ****          ..    ****   |                   ***         |   |      |   |          *******    |   |   ****  ****|              |****        ***                                 ****     |****                     ********         ****     **** ****         ..niche..                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..       | |                                             ..       *****                               *****      |   |             | |     *****         *****              |   |                                                     |   |                                                                 ..stmotif..                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..       | |                                             ..                                                      *****             | |                   | |                *****                                                     *****                                                                 ..ststaple..                          
search RasMol script viewer Motif-ligand binding stats  stturn ..       ***                                             ..                                                                        ***                   ***                                                                                                                                                ..stturn..                          

   New search    3qow:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors