triangle PDBeMotif: 3qir  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification rna binding protein    | release date: Thu, Jan 27, 2011
Title crystal structure of piwil2 paz domain
Authors A.DONG, A.K.WERNIMONT, A.M., C.BIAN, C.BOUNTRA, C.H.ARROWSMITH, C.XU, J.KANIA, J.MIN, J.WEIGELT, STRUCTURAL GENOMICS CONSORTIUM (S
Method X-RAY DIFFRACTION (resolution: 2.45Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVK
EEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLAQQINLSPKQHHSALE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PIWI-LIKE PROTEIN 2
member of: GENE3D:searchG3DSA_2.170.260.10PANTHER:searchPTHR22892/searchPTHR22892_SF30PFAM:searchPF02170PROSITE PROFILES:searchPS50821, SMART:searchSM00949SUPERFAMILY:searchSSF101690/searchSSF53098UniProt:searchQ8TC59
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.....eee..eee.......eee.....eeehhhhhhhhhh.........eeee...............eeehhh.ee..
sequence :  ..NDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDN..LLKGEILLLPELSFMT
seq num:  ..2         12        22        32        42        52        62        72        82        92    ..101       111   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                   |   || || |   |  |^***|    | ||| ||  |  | |  |  ||    | |||||  |       | |   ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                   |   || || |   |  | |^**    | ||^**|  |  | |  |  ||    | |^**|  |       ^**   ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   |   || || |   |  | |       | ||^***  ^*** |  ^***|    | |^***  |             ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..                   |   || || |   |  | |       ***||  |     | |  |   |    | | | |  |             ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                   |   || || |   ******       |  ||  |     | |  |   |    | | | |  |             ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   |   || || |      | |       |  |****     | |  |   |    | | | |  |             ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  nest ..                   |   || || |      ***       |  ||  |     ***  |   |    *** | |  |             ..        ||  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                   |   |******                ********          |   |        ******             ..        |****   
search RasMol script viewer Motif-ligand binding stats  stmotif ..                   |   |                                        *****                           ..        |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                   *****                                                                        ..        *****   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : PIWI-LIKE PROTEIN 2
member of: GENE3D:searchG3DSA_2.170.260.10PANTHER:searchPTHR22892/searchPTHR22892_SF30PFAM:searchPF02170PROSITE PROFILES:searchPS50821, SMART:searchSM00949SUPERFAMILY:searchSSF101690/searchSSF53098UniProt:searchQ8TC59
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee....eeee..eee.......eee.....eeehhhhhhhhhh.........eeee......eeehhh.eee...
sequence :  ..DCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRP..GEILLLPELSFMTGI
seq num:  ..3         13        23        33        43        53        63        73        83       ..104       114  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                  |   || || |   |  |^***|    | ||| ||  |  | |  |  ||    | |||||  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                  |   || || |   |  | |^**    | ||^**|  |  | |  |  ||    | |^**|  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                  |   || || |   |  | |       | ||^***  ^*** |  ^***|    | |^***  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                  |   || || |   |  | |       ***||  |     | |  |   |    | | | |  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                  |   || || |   ******       |  ||  |     | |  |   |    | | | |  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  |   || ****      | |       |  |****     | |  |   |    | | | |  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                  |   || || |      ***       |  ||  |     ***  |   |    *** | |  |       ..     ||  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                  |   |******                ********          |   |        ******       ..     |****     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  |   |                                        *****                     ..     |   |     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  *****                                                                  ..     *****     

chain C : PIWI-LIKE PROTEIN 2
member of: GENE3D:searchG3DSA_2.170.260.10PANTHER:searchPTHR22892/searchPTHR22892_SF30PFAM:searchPF02170PROSITE PROFILES:searchPS50821, SMART:searchSM00949SUPERFAMILY:searchSSF101690/searchSSF53098UniProt:searchQ8TC59
sec str:  .....hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee.....eee..eee.......eee.....eeehhhhhhhhhh.........eeee.....eeehhh.eee...
sequence :  ..RNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRP..EILLLPELSFMTGI
seq num:  ..1         11        21        31        41        51        61        71        81         ..105       115 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                         | || |   |  |^***|    | ||| ||  |  | |  | ||| |  | |||||  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                         | || |   |  | |^**    | ||^**|  |  | |  | ||| |  | |^**|  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                         | || |   |  | |       | ||^***  ^*** |  ^***| |  | |^***  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         | || |   |  | |       ***||  |     | |  | | | |  | | | |  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                         | || |   ******       |  ||  |     | |  | | | |  | | | |  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | ****      | |       |  |****     | |  | | | |  | | | |  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                         | || |      ***       |  ||  |     ***  | | | |  *** | |  |       ..    ||  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                         ******                ********          | | | |      ******       ..    |****     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                 ***** |                   ..    |   |     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                   *****                   ..    *****     

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain D : PIWI-LIKE PROTEIN 2
member of: GENE3D:searchG3DSA_2.170.260.10PANTHER:searchPTHR22892/searchPTHR22892_SF30PFAM:searchPF02170PROSITE PROFILES:searchPS50821, SMART:searchSM00949SUPERFAMILY:searchSSF101690/searchSSF53098UniProt:searchQ8TC59
sec str:  ...hhhhhhhhhhhhhhhhhhhhhhhhhh..eeee....eeee..eee.......eee.....eeehhhhhhhhhh.........eeee.................eee....eeeee.
sequence :  ..DCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRP..ERQDNHGMLLKGEILLLPELSFMTGI
seq num:  ..3         13        23        33        43        53        63        73        83       ..93        103       113   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                       | || |   |  |^***|    | ||| ||  || |||  |  ||    | |||||  |       .. |   | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                       | || |   |  | |^**    | ||^**|  || |||  |  ||    | |^**|  |       ..**   | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                       | || |   |  | |       | ||^***  ^***||  ^***|    | |^***  |       ..     | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..                       | || |   |  | |       ***||  |   | |||  |   |    | | | |  |       ..     | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                       | || |   ******       |  ||  |   *****  |   |    | | | |  |       ..     | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | || |      | |       |  |****   ****|  |   |    | | | |  |       ..     | |        ||  |     
search RasMol script viewer Motif-ligand binding stats  nest ..                       | || |      ***       |  ||  |     ***  |   |    *** | |  |       ..     ***        ||  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                       ******                ********          |   |        ******       ..                |****     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                               *****                     ..                |   |     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                         ..                *****     

   New search    3qir:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors